UniGene Name: sp_v3.0_unigene155234
Length: 164 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene155234
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Dihydrolipoyl dehydrogenase (Fragment) n=1 Tax=Thalassiosira pseudonana RepID=B8LBI2_THAPS | - | - | 1.0e-13 | 73% |
FL-Next | sp=Dihydrolipoyl dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Dihydrolipoyl dehydrogenase | - | - | 1.26117e-44 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Dihydrolipoyl dehydrogenase. | EC:1.8.1.4 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
Sma3 | Citrate cycle (TCA cycle) | 00020 | 0.0 | % | |
Sma3 | Glycine, serine and threonine metabolism | 00260 | 0.0 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 0.0 | % | |
Sma3 | Pyruvate metabolism | 00620 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g48030; At3g17240; CHLREDRAFT_57890; DLDH; DLDH-GCSL; F21D18.28; GCSL; GSVIVT00019672001; LDH; LPD; LPD1; LPD2; LPD_B273; MGD8.7; MICPUCDRAFT_28757; MICPUN_104984; Os01g0328700; Os05g0160000; OsI_01694; OsI_18555; OsJ_01561; OsJ_17207; P0554D10.2; PDH |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | dihydrolipoyl dehydrogenase activity | GO:0004148 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mercuric reductase | IPR000815 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, dimerisation | IPR004099 | - | 0.0 | - |
Sma3 | Dihydrolipoamide dehydrogenase | IPR006258 | - | 0.0 | - |
Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class I, active site | IPR012999 | - | 0.0 | - |
Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G17240.1 | mtLPD2 lipoamide dehydrogenase 2 chr3:5890278-5892166 REVERSE LENGTH=507 | 3.0e-15 | 66% |
RefSeq | Arabidopsis thaliana | NP_175237.1 | dihydrolipoyl dehydrogenase 1 [Arabidopsis thaliana] | 4.0e-15 | 66% |
RefSeq | Populus trichocarpa | XP_002311367.1 | precursor of dehydrogenase dihydrolipoamide dehydrogenase 1 [Populus trichocarpa] | 1.0e-14 | 64% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LQQ4
Fln msg: STOP codon was not found. Distance to subject end: 7 aas, your sequence is shorter than subject: 54 - 502
Fln protein:
S
Protein Length:
55
Fln nts:
T
Fln Alignment:
HLKU4M004IX9HI___KVLGCHMIGPNVGELISEAVLGMEYGCSSEDIARTCHAHPTLTEA
B8LQQ4________________KILGVHIMGPNAGEIIHEAVIALQYGASSEDIARTCHGHPTLSEA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain