UniGene Name: sp_v3.0_unigene155217
Length: 215 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene155217
A |
Ace file of the UniGene sp_v3.0_unigene155217
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | glycine dehydrogenase [Synechococcus sp. RCC307] sp|A5GWN4.1|GCSP_SYNR3 RecName: Full=Glycine dehydrogenase [decarboxylating]; AltName: Full=Glycine cleavage system P-protein; AltName: Full=Glycine decarboxylase emb|CAK29293.1| Glycine dehydrogenase [Syne | - | - | 3.0e-19 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 61% |
| Sma3 | Glycine dehydrogenase [decarboxylating], mitochondrial | - | - | 5.228e-16 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycine dehydrogenase (decarboxylating). | EC:1.4.4.2 | - | 1.233e-26 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 1.233e-26 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.233e-26 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g26080; At4g33010; B1142C05.6-1; B1142C05.6-2; CHLREDRAFT_136984; F26P21.130; GCSP; GDCP; GDCSP; GDCSPA; GDCSPB; GSVIVT00016572001; GSVIVT00032211001; MICPUCDRAFT_24398; MICPUN_104877; OSTLU_26284; Os01g0711400; OsI_03474; OsI_23687; OsJ_03218; OsJ_219 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | glycine cleavage complex | GO:0005960 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | glycine dehydrogenase (decarboxylating) activity | GO:0004375 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
| Sma3 | glycine metabolic process | GO:0006544 | Biological Process | 0.0 | - |
| Sma3 | glycine catabolic process | GO:0006546 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycine cleavage system P protein, homodimeric | IPR003437 | - | 0.0 | - |
| Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26080.1 | AtGLDP2, GLDP2 glycine decarboxylase P-protein 2 chr2:11109330-11113786 REVERSE LENGTH=1044 | 1.0e-20 | 56% |
| RefSeq | Arabidopsis thaliana | NP_180178.1 | glycine dehydrogenase [decarboxylating] 1 [Arabidopsis thaliana] | 2.0e-20 | 56% |
| RefSeq | Populus trichocarpa | XP_002308562.1 | precursor of carboxylase p-protein 1, glycine decarboxylase complex [Populus trichocarpa] | 4.0e-22 | 59% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ48
Fln msg: Distance to subject end: 175 aas, your sequence is shorter than subject: 71 - 780
Fln protein:
V
Protein Length:
72
Fln nts:
A
Fln Alignment:
HLKU4M004IVWLR___VAKHLAEFLPGHPSVPKGAVGGA----QAIGPVSAAPWGSSAILPISWMYINLMGSQGLKKASQVAILNANYMKK
C0PQ48________________VKKHLAPFLPSHPVVPTGGIPAPEDKLQPLGTISAAPWGSALILPISYAYIAMMGSQGLTEASKLAILNANYMAK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta