UniGene Name: sp_v3.0_unigene155089
Length: 179 nt
![]() |
---|
>sp_v3.0_unigene155089
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ADP-ribosylation factor n=2 Tax=Ajellomyces capsulatus RepID=C0NKH9_AJECG | - | - | 7.0e-13 | 85% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
Sma3 | ADP-ribosylation factor | - | - | 4.514e-28 | - |
Source | Gene names |
---|---|
Sma3 | ARF; ARF1; ARF2-A; ARF2-B; ARF3; ARFA1-A; ARFA1-D; ARFA1A; ARFA1B; ARFA2-A; ARFA2-B; ARL1; Arf; Arf1; ArfA11; ArfA12; ArfA13; ArfA14; ArfA15; ArfB1A1; ArfB1B1; ArfB1B2; ArfB21; ArfB22; Arl15L; Arl1A1; Arl1A2; At1g10630; At1g23490; At1g70490; At2g15310; At |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | endosome | GO:0005768 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | phosphatidylinositol 3-kinase complex | GO:0005942 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | 1-phosphatidylinositol-3-kinase activity | GO:0016303 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | vesicle-mediated transport | GO:0016192 | Biological Process | 0.0 | - |
Sma3 | phosphatidylinositol phosphorylation | GO:0046854 | Biological Process | 0.0 | - |
Sma3 | phosphatidylinositol-mediated signaling | GO:0048015 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PAS | IPR000014 | - | 0.0 | - |
Sma3 | Phosphatidylinositol 3-/4-kinase, catalytic domain | IPR000403 | - | 0.0 | - |
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Phosphoinositide 3-kinase, accessory (PIK) domain | IPR001263 | - | 0.0 | - |
Sma3 | Phosphoinositide 3-kinase, C2 | IPR002420 | - | 0.0 | - |
Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
Sma3 | IPR006688 | - | 0.0 | - | |
Sma3 | Small GTPase superfamily, ARF/SAR type | IPR006689 | - | 0.0 | - |
Sma3 | Phosphatidylinositol Kinase | IPR015433 | - | 0.0 | - |
Sma3 | Phosphatidylinositol 3/4-kinase, conserved site | IPR018936 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G62290.1 | ATARFA1E, ARFA1E ADP-ribosylation factor A1E chr3:23052287-23053545 FORWARD LENGTH=181 | 1.0e-16 | 80% |
RefSeq | Arabidopsis thaliana | NP_001190162.1 | ADP-ribosylation factor A1E [Arabidopsis thaliana] | 2.0e-16 | 80% |
RefSeq | Populus trichocarpa | XP_002312302.1 | predicted protein [Populus trichocarpa] | 2.0e-16 | 80% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PPL2
Fln msg: Distance to subject end: 126 aas, your sequence is shorter than subject: 45 - 181
Fln protein:
M
Protein Length:
46
Fln nts:
A
Fln Alignment:
HLKU4M004I6524___TWEDLLSMLNWGKEEKRILMVGLDAAGKTTILYKLKLGETISTIPTIGFGVE
C0PPL2________________TFTKLFSRL-FAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain