UniGene Name: sp_v3.0_unigene155015
Length: 188 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene155015
C |
Ace file of the UniGene sp_v3.0_unigene155015
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | PREDICTED: similar to ADP-ribosylation factor protein n=1 Tax=Ornithorhynchus anatinus RepID=UPI000155C1A8 | - | - | 7.0e-18 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | ADP-ribosylation factor | - | - | 3.132e-27 | - |
| Source | Gene names |
|---|---|
| Sma3 | 24.t00012; ARF; ARF1; ARF2-A; ARF2-B; ARF3; ARFA1-A; ARFA1-D; ARFA1A; ARFA1B; ARFA2-A; ARFA2-B; ARL1; Arf; Arf1; ArfA11; ArfA12; ArfA13; ArfA14; ArfA15; ArfB1A1; ArfB1B1; ArfB1B2; ArfB21; ArfB22; ArfB23; Arl15L; Arl1A1; Arl1A2; At1g10630; At1g23490; At1g7 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | endosome | GO:0005768 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | phosphatidylinositol 3-kinase complex | GO:0005942 | Cellular Component | 0.0 | - |
| Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | 1-phosphatidylinositol-3-kinase activity | GO:0016303 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Sma3 | vesicle-mediated transport | GO:0016192 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol phosphorylation | GO:0046854 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol-mediated signaling | GO:0048015 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol 3-/4-kinase, catalytic domain | IPR000403 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Phosphoinositide 3-kinase, accessory (PIK) domain | IPR001263 | - | 0.0 | - |
| Sma3 | Phosphoinositide 3-kinase, C2 | IPR002420 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | IPR006688 | - | 0.0 | - | |
| Sma3 | Small GTPase superfamily, ARF/SAR type | IPR006689 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol Kinase | IPR015433 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol 3/4-kinase, conserved site | IPR018936 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G10630.1 | ATARFA1F, ARFA1F ADP-ribosylation factor A1F chr1:3513189-3514230 REVERSE LENGTH=181 | 9.0e-25 | 87% |
| RefSeq | Arabidopsis thaliana | NP_177206.1 | ADP-ribosylation factor 2 [Arabidopsis thaliana] | 1.0e-24 | 87% |
| RefSeq | Populus trichocarpa | XP_002320274.1 | predicted protein [Populus trichocarpa] | 4.0e-24 | 85% |
Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PPL2
Fln msg: Distance to subject end: 123 aas, your sequence is shorter than subject: 54 - 181
Fln protein:
M
Protein Length:
55
Fln nts:
C
Fln Alignment:
HLKU4M004IMM3Y___MGSIFAKLFN---PKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE
C0PPL2________________MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta