|
||||||
|
UniGene Name: sp_v3.0_unigene154988
Length: 224 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene154988
C |
|
Ace file of the UniGene sp_v3.0_unigene154988
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome P450 n=1 Tax=Populus trichocarpa RepID=B9IAX0_POPTR | - | - | 8.0e-25 | 67% |
| FL-Next | tr=Cytochrome P450 90A20; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
| Sma3 | Steroid 22-alpha-hydroxylase | - | - | 2.166e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.14.-.- | - | 7.773e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | AP22.10; AT5G05690; At3g50660; At4g36380; At5g05690; C7A10.980; CPD; CYP720B2; CYP724B1; CYP724B2; CYP724B7; CYP87D5; CYP90; CYP90A1; CYP90A15; CYP90A2; CYP90A6v1; CYP90A7; CYP90B; CYP90B1; CYP90B7v1; CYP90C1; D11; DWF4; F23E13.220; GSVIVT00020626001; GSV |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | steroid 22-alpha hydroxylase activity | GO:0010012 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen | GO:0016709 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | skotomorphogenesis | GO:0009647 | Biological Process | 0.0 | - |
| Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid homeostasis | GO:0010268 | Biological Process | 0.0 | - |
| Sma3 | leaf shaping | GO:0010358 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid biosynthetic process | GO:0016132 | Biological Process | 0.0 | - |
| Sma3 | monopolar cell growth | GO:0042814 | Biological Process | 0.0 | - |
| Sma3 | leaf development | GO:0048366 | Biological Process | 0.0 | - |
| Sma3 | petal development | GO:0048441 | Biological Process | 0.0 | - |
| Sma3 | stamen development | GO:0048443 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Bacterioferritin | IPR002024 | - | 0.0 | - |
| Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G50660.1 | DWF4, CYP90B1, CLM, SNP2, SAV1, PSC1 Cytochrome P450 superfamily protein chr3:18814262-18817168 REVERSE LENGTH=513 | 1.0e-25 | 52% |
| RefSeq | Arabidopsis thaliana | NP_190635.1 | cytochrome P450 90B1 [Arabidopsis thaliana] | 2.0e-25 | 52% |
| RefSeq | Populus trichocarpa | XP_002321213.1 | cytochrome P450 [Populus trichocarpa] | 4.0e-32 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWM7
Fln msg: Distance to subject end: 47 aas, your sequence is shorter than subject: 74 - 487
Fln protein:
H
Protein Length:
75
Fln nts:
C
Fln Alignment:
HLKU4M004H3SDW___RKALKDIKFKDFQIPAGWKVLPVFTGVHLDESLYKDALEFDPWRWQ-----MQCSRQFMPFGGGPRLCPGYELAKVEI
A9NWM7________________RRALCDVEIKGFNIPQDWLVFPCFRAVHLDQELYSDARKFNPWRWQGNHPSTSSGTVFTPFGGGPRLCPGYELARVEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
