UniGene Name: sp_v3.0_unigene154820
Length: 137 nt
![]() |
---|
>sp_v3.0_unigene154820
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glutathione peroxidase n=1 Tax=Nelumbo nucifera RepID=A3FPF8_NELNU | - | - | 2.0e-13 | 81% |
FL-Next | sp=Glutathione peroxidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Glutathione peroxidase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phospholipid-hydroperoxide glutathione peroxidase. | EC:1.11.1.12 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione metabolism | 00480 | 0.0 | % | |
Sma3 | Glutathione peroxidase. | EC:1.11.1.9 | - | 8.223e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glutathione metabolism | 00480 | 8.223e-19 | % | |
Sma3 | Arachidonic acid metabolism | 00590 | 8.223e-19 | % |
Source | Gene names |
---|---|
Sma3 | At1g63460; At2g25080; At2g31570; At2g43350; At2g48150; At4g11600; At4g31870; BarPHGPX; CHLREDRAFT_188373; CSA; F11C18.70; F11L15.5; F13D4.40; F2K11.16; GP; GP1; GPX; GPX1; GPX2; GPX3; GPX4; GPX5; GPX6; GPX7; GPX8; GPXHA-1; GPXHA-2; GPXMC1; GPXle-1; GPx; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | glutathione peroxidase activity | GO:0004602 | Molecular Function | 0.0 | - |
Sma3 | phospholipid-hydroperoxide glutathione peroxidase activity | GO:0047066 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
Sma3 | cellular response to water deprivation | GO:0042631 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | PWWP | IPR000313 | - | 0.0 | - |
Sma3 | Glutathione peroxidase | IPR000889 | - | 0.0 | - |
Sma3 | RNA polymerase II, large subunit, CTD | IPR006569 | - | 0.0 | - |
Sma3 | IPR012335 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G11600.1 | ATGPX6, PHGPX, LSC803, GPX6 glutathione peroxidase 6 chr4:7010021-7011330 REVERSE LENGTH=232 | 2.0e-18 | 79% |
RefSeq | Arabidopsis thaliana | NP_192897.2 | glutathione peroxidase [Arabidopsis thaliana] | 3.0e-18 | 79% |
RefSeq | Populus trichocarpa | XP_002299536.1 | glutathione peroxidase [Populus trichocarpa] | 1.0e-18 | 79% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NS67
Fln msg: Distance to subject end: 88 aas, your sequence is shorter than subject: 45 - 170
Fln protein:
V
Protein Length:
46
Fln nts:
T
Fln Alignment:
HLKU4M004J0687___VNVASQCGYTNQNYQELQSLYKKYKQQGLEILAFPCNQFGNQE
A9NS67________________VNVASQCGLTNSNYKELSEVYAKYKDQGLEILAFPCNQFGGQE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain