|
||||||
|
UniGene Name: sp_v3.0_unigene154146
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene154146
T |
|
Ace file of the UniGene sp_v3.0_unigene154146
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Calreticulin n=1 Tax=Ectocarpus siliculosus RepID=D7FZD0_ECTSI | - | - | 4.0e-29 | 69% |
| FL-Next | tr=Calreticulin; Pinus taeda (Loblolly pine). | - | - | 0.0 | 54% |
| Sma3 | Calreticulin | - | - | 2.239e-22 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G56340; At1g09210; At1g56340; CAL1; CHLREDRAFT_78954; CRT1; CRT2; CRTL; F13N6.20; F14G9.5; GSVIVT00028103001; LOC_Os03g61670; MICPUN_64687; OSJNBa0078D06.28; Os03g0832200; OsI_14188; OsJ_13241; PHATRDRAFT_41172; POPTRDRAFT_729432; POPTRDRAFT_811231; T1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calreticulin/calnexin | IPR001580 | - | 0.0 | - |
| Sma3 | Calreticulin/calnexin, P | IPR009033 | - | 0.0 | - |
| Sma3 | Calreticulin | IPR009169 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | Calreticulin/calnexin, conserved site | IPR018124 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G09210.1 | CRT1b, AtCRT1b calreticulin 1b chr1:2973217-2976655 REVERSE LENGTH=424 | 3.0e-23 | 54% |
| RefSeq | Arabidopsis thaliana | NP_172392.1 | calreticulin-2 [Arabidopsis thaliana] | 3.0e-23 | 54% |
| RefSeq | Populus trichocarpa | XP_002318957.1 | predicted protein [Populus trichocarpa] | 1.0e-25 | 56% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9FYV2
Fln msg: Distance to subject end: 78 aas, your sequence is shorter than subject: 80 - 427
Fln protein:
D
Protein Length:
81
Fln nts:
T
Fln Alignment:
HLKU4M004JGKAB___NPDYKGPWKAKQIPNPAYIGEWEHPLIPNPDYTEDAELHHRCKDCTHVGFELWQVKSGTIFDDIFVSDSLEEAKAYADE
Q9FYV2________________NPEYKGPWKPKKIKNPNYKGKWKAPMIDNPDFKDDPEL-YVFPNLKYLGIELWQVKSGTLFDNILISDDPEYAKKLAEE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
