SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene153848

Length: 232 nt

UniGene Fasta

>sp_v3.0_unigene153848
CGCAACGGCCGACCATCCGTTTATCGTTCGGCTCTACTACAGCTTCCAGACGACCGAGTGCATCTACTTCGTCATGGAGTACTGTGCTGGCGGCGAGTTCTTCCGCACACTGCAGAAGCAGCCGGAGCGACGCCTGCCCGAGACCGTGGCCCGGTTCTACGCCAGCGAAGTGCTGCTAGCGCTCGAGTATCTCCATGCGCTCGGCTTTATCTACCGCGATCTCAAGCCCGAA

Ace file of the UniGene sp_v3.0_unigene153848

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Serine/threonine-protein kinase ppk14 n=1 Tax=Capsaspora owczarzaki ATCC 30864 RepID=E9C6X2_9EUKA	-	-	2.0e-27	72%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	55%
Sma3	Phototropin	-	-	1.904e-36	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific serine/threonine protein kinase.	EC:2.7.11.1	-	1.589e-14	-
Sma3	Protein kinase C.	EC:2.7.11.13	-	5.224e-12	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Phosphatidylinositol signaling system	04070		5.224e-12	%

Source	Gene names
Sma3	AT3G45780; AT4g26610; ATPK64; AcNPH1; Adi3; At1g16440; At1g79250; At2g34650; At2g36350; At2g44830; At3g12690; At3g27580; At3g45780; At3g52890; At4g26610; At5g03640; At5g40030; At5g55910; At5g58140; B1279D09.7; Bcpk1; CAV1; CHLREDRAFT_183965; F17C15_60; F3

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	Golgi apparatus	GO:0005794	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	internal side of plasma membrane	GO:0009898	Cellular Component	-
Sma3	cell surface	GO:0009986	Cellular Component	-
Sma3	two-component sensor activity	GO:0000155	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	G-protein coupled photoreceptor activity	GO:0008020	Molecular Function	-
Sma3	blue light photoreceptor activity	GO:0009882	Molecular Function	-
Sma3	FMN binding	GO:0010181	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	two-component signal transduction system (phosphorelay)	GO:0000160	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	sensory perception	GO:0007600	Biological Process	-
Sma3	phototropism	GO:0009638	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	chloroplast relocation	GO:0009902	Biological Process	-
Sma3	chloroplast avoidance movement	GO:0009903	Biological Process	-
Sma3	chloroplast accumulation movement	GO:0009904	Biological Process	-
Sma3	auxin polar transport	GO:0009926	Biological Process	-
Sma3	stomatal movement	GO:0010118	Biological Process	-
Sma3	regulation of stomatal movement	GO:0010119	Biological Process	-
Sma3	regulation of proton transport	GO:0010155	Biological Process	-
Sma3	negative regulation of anion channel activity by blue light	GO:0010362	Biological Process	-
Sma3	protein-chromophore linkage	GO:0018298	Biological Process	-
Sma3	protein autophosphorylation	GO:0046777	Biological Process	-
Sma3	root hair initiation	GO:0048766	Biological Process	-
Sma3	root hair elongation	GO:0048767	Biological Process	-
Sma3	cotyledon development	GO:0048825	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	PAS	IPR000014	-	-
Sma3	PAS-associated, C-terminal	IPR000700	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	AGC-kinase, C-terminal	IPR000961	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Phytochrome	IPR001294	-	-
Sma3	PAC motif	IPR001610	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	GAF domain	IPR003018	-	-
Sma3	Domain of unknown function DUF591	IPR007649	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Phytochrome, central region	IPR013515	-	-
Sma3	Phytochrome chromophore binding site	IPR013516	-	-
Sma3	PAS fold-2	IPR013654	-	-
Sma3	PAS fold-3	IPR013655	-	-
Sma3	PAS fold	IPR013767	-	-
Sma3	Phytochrome chromophore attachment domain	IPR016132	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Protein kinase, C-terminal	IPR017892	-	-
Sma3	Tubulin, conserved site	IPR017975	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G12690.1	AGC1.5 AGC kinase 1.5 chr3:4030596-4032400 REVERSE LENGTH=577	1.0e-24	62%
RefSeq	Arabidopsis thaliana	NP_974296.1	AGC kinase 1.5 [Arabidopsis thaliana]	2.0e-24	62%
RefSeq	Populus trichocarpa	XP_002312217.1	predicted protein [Populus trichocarpa]	8.0e-24	59%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NVL2

Fln msg: Distance to subject end: 264 aas, your sequence is shorter than subject: 77 - 506

Fln protein: ATADHPFIVRLYYSFQTTECIYFVMEYCAGGEFFRTLQKQPERRLPETVARFYASEVLLALEYLHALGFIYRDLKPE

Protein Length: 78

Fln nts: CGCAACGGCCGACCATCCGTTTATCGTTCGGCTCTACTACAGCTTCCAGACGACCGAGTGCATCTACTTCGTCATGGAGTACTGTGCTGGCGGCGAGTTCTTCCGCACACTGCAGAAGCAGCCGGAGCGACGCCTGCCCGAGACCGTGGCCCGGTTCTACGCCAGCGAAGTGCTGCTAGCGCTCGAGTATCTCCATGCGCTCGGCTTTATCTACCGCGATCTCAAGCCCGAA

Fln Alignment:

HLKU4M004I03IN___ATADHPFIVRLYYSFQTTECIYFVMEYCAGGEFFRTLQKQPERRLPETVARFYASEVLLALEYLHALGFIYRDLKPE
A9NVL2________________SSLDHPFLPTLYTHFETEQFSCLVMEYCSGGDLHTFRQRQPAKRFSEEAVRFYASEVLLALEYLHMMGVVYRDLKPE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain