UniGene Name: sp_v3.0_unigene153616
Length: 198 nt
UniGene Fasta |
---|
>sp_v3.0_unigene153616
C |
Ace file of the UniGene sp_v3.0_unigene153616 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aminotransferase, classes I and II family protein n=1 Tax=Tetrahymena thermophila SB210 RepID=Q23JV0_TETTH | - | - | 5.0e-17 | 65% |
FL-Next | sp=Aspartate aminotransferase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Aspartate aminotransferase | - | - | 2.039e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aspartate transaminase. | EC:2.6.1.1 | - | 2.879e-23 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 2.879e-23 | % | |
Sma3 | Cysteine and methionine metabolism | 00270 | 2.879e-23 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 2.879e-23 | % | |
Sma3 | Tyrosine metabolism | 00350 | 2.879e-23 | % | |
Sma3 | Phenylalanine metabolism | 00360 | 2.879e-23 | % | |
Sma3 | Phenylalanine, tyrosine and tryptophan biosynthesis | 00400 | 2.879e-23 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 2.879e-23 | % | |
Sma3 | Isoquinoline alkaloid biosynthesis | 00950 | 2.879e-23 | % | |
Sma3 | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 2.879e-23 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.879e-23 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 2.879e-23 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 2.879e-23 | % | |
Sma3 | Metabolic pathways | 01100 | 2.879e-23 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.879e-23 | % |
Source | Gene names |
---|---|
Sma3 | AAT; AAT-1; AAT-P1; CRAAT1; PHYPADRAFT_169868; pcAAT2; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | L-aspartate:2-oxoglutarate aminotransferase activity | GO:0004069 | Molecular Function | 0.0 | - |
Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
Sma3 | cellular amino acid metabolic process | GO:0006520 | Biological Process | 0.0 | - |
Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aspartate/other aminotransferase | IPR000796 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Aminotransferase, class I/classII | IPR004839 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G11520.1 | ASP3, YLS4 aspartate aminotransferase 3 chr5:3685257-3687721 REVERSE LENGTH=449 | 3.0e-17 | 56% |
RefSeq | Arabidopsis thaliana | NP_196713.1 | aspartate aminotransferase [Arabidopsis thaliana] | 4.0e-17 | 56% |
RefSeq | Populus trichocarpa | XP_002321073.1 | predicted protein [Populus trichocarpa] | 3.0e-16 | 53% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NUJ0
Fln msg: your sequence is shorter than subject: 64 - 431
Fln protein:
H
Protein Length:
65
Fln nts:
C
Fln Alignment:
HLKU4M004IOW0C___HHIVDQIGMFSFTGLQPHQVKVLTDKYHIYLVSNGRVSMAGFNTKNVNYVADAIKDAVVNAKK
A9NUJ0________________NHVTDQIGMFCYSGMTPEQVDRLTSEFHIYLTRNGRISMAGVTTGNVEYLANAIHEVTKSSEK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain