SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene153109

Length: 446 nt

UniGene Fasta

>sp_v3.0_unigene153109
CCAGCGAACGCTCATGGAGCTGCTCAACCAGCTCGACGGCTTCGACGCCCTCGGCCAAGTCAAGATGGTCATGGCTACAAACCGACCGGACATTCTGGACCCGGCGCTTCTGCGTCCAGGTCGACTCGACCGAAAGATCGAGATCCCGCTGCCCAACGAGGCCTCGCGCATGGACATTCTCAAGATCCACTCGGGTCCGATCACCAAGAAGGGCGACATCGACTACGAGTCGATCGTCAAGCTCACGGACGGCTTCAACGGCGCCGATATCCGAAACGTGTGCACTGAAGCCGGCATGTTCGCCATCCGAGCGGACCGCGAGTACGTCATCGAGGAGGACTTCATGAAGGCCGCGCGCAAGCTGTCCGAAAGTCAAGAAGCTCGAGTCGAAGATGGACTACAGCAAGGTATAAACATGCCAGCCCACACCACACAGGAGCAGACAC

Ace file of the UniGene sp_v3.0_unigene153109

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	26S protease regulatory subunit S10B n=1 Tax=Phytophthora infestans T30-4 RepID=D0MQ98_PHYIT	-	-	0.0	94%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	78%
Sma3	Proteasomal ATPase	-	-	7.001e-14	-

Source	ECs	Term	Type	e value	Identity
Sma3	Microtubule-severing ATPase.	EC:3.6.4.3	-	6.82e-16	-

Source	Gene names
Sma3	26S proteasome subunit; AT3G09840; AT4g29040; At1g09100; At1g45000; At1g45000/F27F5.8; At1g53750; At2g20140; At3g05530; At3g05530/F22F7.1; At3g09840; At3g53230; At4g29040; At5g03340; At5g19990; At5g20000; At5g43010; At5g58290; AtSUG1; BrTBP; CDC48; CDC48A

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	Golgi apparatus	GO:0005794	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	cytoskeleton	GO:0005856	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	flagellum	GO:0019861	Cellular Component	-
Sma3	protein complex	GO:0043234	Cellular Component	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	peptidase activity	GO:0008233	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	ATPase activity, uncoupled	GO:0042624	Molecular Function	-
Sma3	intracellular protein transport	GO:0006886	Biological Process	-
Sma3	cell cycle	GO:0007049	Biological Process	-
Sma3	protein transport	GO:0015031	Biological Process	-
Sma3	protein catabolic process	GO:0030163	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	cell division	GO:0051301	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	NSF attachment protein	IPR000744	-	-
Sma3	CDC48, N-terminal subdomain	IPR003338	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	ATPase, AAA-type, conserved site	IPR003960	-	-
Sma3	CDC48, domain 2	IPR004201	-	-
Sma3	26S proteasome subunit P45	IPR005937	-	-
Sma3	ATPase, AAA-type, CDC48	IPR005938	-	-
Sma3	Aspartate decarboxylase-like fold	IPR009010	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT5G43010.1	RPT4A regulatory particle triple-A ATPase 4A chr5:17248563-17251014 REVERSE LENGTH=399	81%
RefSeq	Arabidopsis thaliana	NP_199115.1	regulatory particle triple-A ATPase 4A [Arabidopsis thaliana]	81%
RefSeq	Populus trichocarpa	XP_002313775.1	predicted protein, partial [Populus trichocarpa]	80%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LLX8

Fln msg: STOP codon was not found. Distance to subject end: 8 aas, your sequence is shorter than subject: 148 - 398

Fln protein: QRTLMELLNQLDGFDALGQVKMVMATNRPDILDPALLRPGRLDRKIEIPLPNEASRMDILKIHSGPITKKGDIDYESIVKLTDGFNGADIRNVCTEAGMFAIRADREYVIEEDFMKAARKLSESQEARVEDGLQQGINMPAHTTQEQT

Protein Length: 149

Fln nts: CCAGCGAACGCTCATGGAGCTGCTCAACCAGCTCGACGGCTTCGACGCCCTCGGCCAAGTCAAGATGGTCATGGCTACAAACCGACCGGACATTCTGGACCCGGCGCTTCTGCGTCCAGGTCGACTCGACCGAAAGATCGAGATCCCGCTGCCCAACGAGGCCTCGCGCATGGACATTCTCAAGATCCACTCGGGTCCGATCACCAAGAAGGGCGACATCGACTACGAGTCGATCGTCAAGCTCACGGACGGCTTCAACGGCGCCGATATCCGAAACGTGTGCACTGAAGCCGGCATGTTCGCCATCCGAGCGGACCGCGAGTACGTCATCGAGGAGGACTTCATGAAGGCCGCGCGCAAGCTGTCCGAAAGTCAAGAAGCTCGAGTCGAAGATGGACTACAGCAAGGTATAAACATGCCAGCCCACACCACACAGGAGCAGACAC

Fln Alignment:

HLKU4M004JA1AW___QRTLMELLNQLDGFDALGQVKMVMATNRPDILDPALLRPGRLDRKIEIPLPNEASRMDILKIHSGPITKKGDIDYESIVKLTDGFNGADIRNVCTEAGMFAIRADREYVIEEDFMKAARKLSESQE
B8LLX8________________QRTLMELLNQLDGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQARMEVLKIHAAGIAKHGDIDYEAVVKLAEGFNGADLRNVCTEAGMSAIRAERDYVIHEDFMKAVRKLNEAKK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain