|
||||||
|
UniGene Name: sp_v3.0_unigene152615
Length: 164 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene152615
C |
|
Ace file of the UniGene sp_v3.0_unigene152615
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Benzoquinone reductase n=3 Tax=Gossypium hirsutum RepID=A3F7Q2_GOSHI | - | - | 2.0e-15 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
| Sma3 | Minor allergen Alt a, putative | - | - | 6.153e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 2-hydroxy-1,4-benzoquinone reductase. | EC:1.6.5.7 | - | 3.367e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Chlorocyclohexane and chlorobenzene degradation | 00361 | 3.367e-08 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 3.367e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.367e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | AGG3; AT4g27270; AT4g36750; At4g27270; At5g54500; B1070A12.15; C7A10.610; CHLREDRAFT_182581; CHLREDRAFT_182582; CHLREDRAFT_187688; CHLREDRAFT_8673; FAP191; GSVIVT00005136001; GSVIVT00005137001; GSVIVT00008488001; GSVIVT00024134001; GSVIVT00024987001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
| Sma3 | NADPH:quinone reductase activity | GO:0003960 | Molecular Function | 0.0 | - |
| Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as acceptor | GO:0016655 | Molecular Function | 0.0 | - |
| Sma3 | 2-hydroxy-1,4-benzoquinone reductase activity | GO:0050625 | Molecular Function | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphotransferase system, HPr serine phosphorylation site | IPR002114 | - | 0.0 | - |
| Sma3 | EMSY N-terminal | IPR005491 | - | 0.0 | - |
| Sma3 | Flavodoxin/nitric oxide synthase | IPR008254 | - | 0.0 | - |
| Sma3 | Flavoprotein WrbA | IPR010089 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G54500.2 | FQR1 flavodoxin-like quinone reductase 1 chr5:22124674-22126435 FORWARD LENGTH=244 | 7.0e-20 | 72% |
| RefSeq | Arabidopsis thaliana | NP_200261.1 | flavodoxin-like quinone reductase 1 [Arabidopsis thaliana] | 7.0e-20 | 72% |
| RefSeq | Populus trichocarpa | XP_002316953.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRI9
Fln msg: Distance to subject end: 92 aas, your sequence is shorter than subject: 54 - 203
Fln protein:
T
Protein Length:
55
Fln nts:
C
Fln Alignment:
HLKU4M004JBUZU___TSVPVIDVHKLPEADGFLFGFPTRFGGVPAQFKAFFDATGGLWLQGALAGKPAG
B8LRI9________________TKVPTIEPQQLADADGLLFGFPTRYGMMAAQFKAFLDATGGLWRTQQLAGKPAG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
