UniGene Name: sp_v3.0_unigene152374
Length: 248 nt
![]() |
---|
>sp_v3.0_unigene152374
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phosphoglycerate kinase n=2 Tax=Hypocrea RepID=PGK_TRIVI | - | - | 2.0e-21 | 64% |
FL-Next | sp=Phosphoglycerate kinase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
Sma3 | Phosphoglycerate kinase | - | - | 3.02e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoglycerate kinase. | EC:2.7.2.3 | - | 5.732e-31 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 5.732e-31 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 5.732e-31 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 5.732e-31 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 5.732e-31 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 5.732e-31 | % | |
Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 5.732e-31 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 5.732e-31 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 5.732e-31 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 5.732e-31 | % | |
Sma3 | Metabolic pathways | 01100 | 5.732e-31 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 5.732e-31 | % |
Source | Gene names |
---|---|
Sma3 | At1g79550; At1g79550/T8K14.3; PGK; PGK2; PGK5; PGKP; T8K14.3; THAPSDRAFT_25116; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | phosphoglycerate kinase activity | GO:0004618 | Molecular Function | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoglycerate kinase | IPR001576 | - | 0.0 | - |
Sma3 | Phosphoglycerate kinase, N-terminal | IPR015824 | - | 0.0 | - |
Sma3 | Phosphoglycerate kinase, C-terminal | IPR015901 | - | 0.0 | - |
Sma3 | Phosphoglycerate kinase, conserved site | IPR015911 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G56190.1 | Phosphoglycerate kinase family protein chr1:21028403-21030454 FORWARD LENGTH=478 | 1.0e-16 | 57% |
RefSeq | Arabidopsis thaliana | NP_001117503.1 | phosphoglycerate kinase [Arabidopsis thaliana] | 9.0e-17 | 57% |
RefSeq | Populus trichocarpa | XP_002315067.1 | predicted protein [Populus trichocarpa] | 2.0e-16 | 57% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKQ1
Fln msg: Distance to subject end: 172 aas, your sequence is shorter than subject: 82 - 472
Fln protein:
S
Protein Length:
83
Fln nts:
C
Fln Alignment:
HLKU4M004H9P5G___FRKFLSSLADVYVNDAFGAAHRAHSSIVGID--VQQRVAGLLMKKELVYFSKALESPKRPFLAILG
B8LKQ1________________FAKKLASVADLYVNDAFGTAHRAHASTEGVTKYLKPAVAGFLMQKELDYLVGAVSVPKRPFAAIVG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain