|
||||||
|
UniGene Name: sp_v3.0_unigene152152
Length: 211 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene152152
C |
|
Ace file of the UniGene sp_v3.0_unigene152152
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 40S ribosomal protein S4 n=1 Tax=Aedes aegypti RepID=Q5QC96_AEDAE | - | - | 6.0e-17 | 69% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
| Sma3 | 40S ribosomal protein S4 | - | - | 7.033e-21 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G07090; At2g17360; At5g07090; At5g58420; BiRP1; CHLREDRAFT_188837; F5J6.12; GSVIVT00001285001; GSVIVT00024035001; MICPUCDRAFT_36856; MOJ9.26; MQJ2_10; OJ1393_A07.10; Os01g0358400; Os02g0105900; Os05g0368300; OsI_01884; OsI_05494; OsI_19685; OsJ_01737; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
| Sma3 | cytosolic small ribosomal subunit | GO:0022627 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | rRNA binding | GO:0019843 | Molecular Function | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein S4e | IPR000876 | - | 0.0 | - |
| Sma3 | RNA-binding S4 domain | IPR002942 | - | 0.0 | - |
| Sma3 | KOW | IPR005824 | - | 0.0 | - |
| Sma3 | Ribosomal protein S4e, N-terminal | IPR013843 | - | 0.0 | - |
| Sma3 | Ribosomal protein S4e, central | IPR013845 | - | 0.0 | - |
| Sma3 | Ribosomal protein S4e, N-terminal, conserved site | IPR018199 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G17360.1 | Ribosomal protein S4 (RPS4A) family protein chr2:7546598-7548138 FORWARD LENGTH=261 | 3.0e-20 | 69% |
| RefSeq | Arabidopsis thaliana | NP_001189539.1 | 40S ribosomal protein S4-1 [Arabidopsis thaliana] | 2.0e-20 | 69% |
| RefSeq | Populus trichocarpa | XP_002318967.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-20 | 69% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NNW1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 132 aas, your sequence is shorter than subject: 69 - 263
Fln protein:
L
Protein Length:
70
Fln nts:
C
Fln Alignment:
HLKU4M004IO6VA___GKVRTDPRFPSGFMDVISIEKTNEQLRLLYDVTGRFVPHRITDEEAKFKLVKVREV
A9NNW1________________GKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAKYKLCKVRSV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
