|
||||||
|
UniGene Name: sp_v3.0_unigene152081
Length: 233 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene152081
T |
|
Ace file of the UniGene sp_v3.0_unigene152081 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Nucleoside diphosphate kinase n=1 Tax=Ostreococcus lucimarinus CCE9901 RepID=A4S6Z0_OSTLU | - | - | 1.0e-20 | 77% |
| FL-Next | sp=Nucleoside diphosphate kinase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
| Sma3 | Nucleoside diphosphate kinase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nucleoside-diphosphate kinase. | EC:2.7.4.6 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 0.0 | % | |
| Sma3 | Pyrimidine metabolism | 00240 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4G11010; At4g09320; At4g11010; At4g23900; At5g63310; Bc-NDPK1; Bc-NDPK3; BcNDK 2; BcNDK I; BcNDK III; CHLREDRAFT_180172; CHLREDRAFT_58944; F25I24.220; F8M12.12; FAP103; GSVIVT00006748001; GSVIVT00010474001; GSVIVT00019061001; LOC_Os10g41410; MDC12.28; M |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial intermembrane space | GO:0005758 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside diphosphate kinase activity | GO:0004550 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | GTP biosynthetic process | GO:0006183 | Biological Process | 0.0 | - |
| Sma3 | UTP biosynthetic process | GO:0006228 | Biological Process | 0.0 | - |
| Sma3 | CTP biosynthetic process | GO:0006241 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to UV | GO:0009411 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
| Sma3 | red or far-red light signaling pathway | GO:0010017 | Biological Process | 0.0 | - |
| Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Nucleoside diphosphate kinase | IPR001564 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G09320.1 | NDPK1 Nucleoside diphosphate kinase family protein chr4:5923424-5924366 FORWARD LENGTH=169 | 4.0e-27 | 75% |
| RefSeq | Arabidopsis thaliana | NP_567346.1 | nucleoside diphosphate kinase 1 [Arabidopsis thaliana] | 5.0e-27 | 75% |
| RefSeq | Populus trichocarpa | XP_002302498.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-25 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NZL7
Fln msg: your sequence is shorter than subject: 64 - 144
Fln protein:
W
Protein Length:
65
Fln nts:
T
Fln Alignment:
HLKU4M004JGQ4F___WEGKNAIIEGRKIIGATNPAQSEPGSIRGDLCIEVGRNIIHGSDSAESAKHEIALWF
A9NZL7________________WEGKGVVATGRKIIGATNPAASEPGTIRGDFAVEIGRNVIHGSDAVESAKKEIALWF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
