UniGene Name: sp_v3.0_unigene151858
Length: 220 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene151858
A |
Ace file of the UniGene sp_v3.0_unigene151858 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase (ISS) [Ostreococcus tauri] emb|CAL58329.1| UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase (ISS) [Ostreococcus tauri] | - | - | 2.0e-24 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
Sma3 | RHM1 | - | - | 1.649e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidoreductases, Acting on the CH-OH group of donors, With NAD(+) or NADP(+) as acceptor. | EC:1.1.1.- | - | 3.237e-09 | - |
Source | Gene names |
---|---|
Sma3 | At1g53500; At1g63000; At1g78570; At3g14790; CHLREDRAFT_158152; EZY22; F16P17.17; F22G10.13; GSVIVT00000750001; GSVIVT00001074001; GSVIVT00027921001; LOC_Os03g17000; MICPUCDRAFT_32377; MICPUN_93721; MUM4; NRS/ER; OSJNBb0005A04.29; Os03g0278200; OsI_08465; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | soluble fraction | GO:0005625 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | UDP-L-rhamnose synthase activity | GO:0010280 | Molecular Function | 0.0 | - |
Sma3 | UDP-4-keto-6-deoxy-glucose-3,5-epimerase activity | GO:0010489 | Molecular Function | 0.0 | - |
Sma3 | UDP-4-keto-rhamnose-4-keto-reductase activity | GO:0010490 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
Sma3 | UDP-glucose 4,6-dehydratase activity | GO:0050377 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | mucilage biosynthetic process | GO:0010192 | Biological Process | 0.0 | - |
Sma3 | seed coat development | GO:0010214 | Biological Process | 0.0 | - |
Sma3 | UDP-rhamnose biosynthetic process | GO:0010253 | Biological Process | 0.0 | - |
Sma3 | auxin efflux | GO:0010315 | Biological Process | 0.0 | - |
Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G63000.1 | NRS/ER, UER1 nucleotide-rhamnose synthase/epimerase-reductase chr1:23342510-23343859 FORWARD LENGTH=301 | 1.0e-28 | 64% |
RefSeq | Arabidopsis thaliana | NP_564806.1 | 3,5-epimerase/4-reductase [Arabidopsis thaliana] | 1.0e-28 | 64% |
RefSeq | Populus trichocarpa | XP_002330754.1 | predicted protein [Populus trichocarpa] | 2.0e-30 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NN20
Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 73 - 300
Fln protein:
T
Protein Length:
74
Fln nts:
A
Fln Alignment:
HLKU4M004IJ45U___THILNAAGVTGRPNVDWCEDHRLETIRSNVIGTLTVADVAEEKNIHHTLFATGCIFEYDEEHQIG-GKGFTEED
A9NN20________________THVFNAAGVTGRPNVDWCESHKVETIRTNVVGTLNLADLCRQHGLILINYATGCIFEYDEKHPLGSGIGFKEED
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain