UniGene Name: sp_v3.0_unigene151659
Length: 169 nt
UniGene Fasta |
---|
>sp_v3.0_unigene151659
G |
Ace file of the UniGene sp_v3.0_unigene151659 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Polyprotein (Fragment) n=2 Tax=Musa acuminata subsp. malaccensis RepID=A8YPM5_MUSAC | - | - | 1.0e-16 | 67% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 69% |
Source | Gene names |
---|---|
Sma3 | VITISV_000027; VITISV_001313; VITISV_003931; VITISV_005867; VITISV_008296; VITISV_008420; VITISV_009385; VITISV_013369; VITISV_014071; VITISV_016761; VITISV_020318; VITISV_028502; VITISV_029702; VITISV_031913; VITISV_032357; VITISV_035145; VITISV_037851; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AQF1
Fln msg: Distance to subject end: 534 aas, your sequence is shorter than subject: 56 - 1217
Fln protein:
Q
Protein Length:
57
Fln nts:
G
Fln Alignment:
HLKU4M004ILOBG___QDGHLVAYESWKLQDREQRYPVHEKEMIAIIHCLHVWRHYLMGKSFVVKTDNVATS
A5AQF1________________QERHLIAFESRKLNDAERRYTVQEKEMTAIVHCLHTWRHYLLGSHFIVKTDNVATS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain