UniGene Name: sp_v3.0_unigene151540
Length: 219 nt
![]() |
---|
>sp_v3.0_unigene151540
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Elongation factor Tu n=4 Tax=Betaproteobacteria RepID=EFTU_AROAE | - | - | 5.0e-33 | 94% |
FL-Next | sp=Elongation factor Tu; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | EF-Tu | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | AT4G20360; At4g02930; At4g20360; CHLREDRAFT_98182; EF-Tu; EFG8; F9F13.10; GSVIVT00015974001; GSVIVT00020631001; GSVIVT00023656001; Grc000074; Heak293_Cp119; LOC_Os03g63410; MICPUCDRAFT_32374; MICPUN_90282; MicpuC_chl6; OJ1126_D09.31-1; OJ1126_D09.31-2; OS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | nucleoid | GO:0009295 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | cyanelle | GO:0009842 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | translational elongation | GO:0006414 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein synthesis factor, GTP-binding | IPR000795 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTu/EF1A, C-terminal | IPR004160 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTu/EF1A, domain 2 | IPR004161 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTu/EF1A, bacterial/organelle | IPR004541 | - | 0.0 | - |
Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02930.1 | GTP binding Elongation factor Tu family protein chr4:1295751-1298354 REVERSE LENGTH=454 | 3.0e-29 | 65% |
RefSeq | Arabidopsis thaliana | NP_192202.1 | Elongation factor Tu [Arabidopsis thaliana] | 3.0e-29 | 65% |
RefSeq | Populus trichocarpa | XP_002302831.1 | predicted protein [Populus trichocarpa] | 2.0e-29 | 65% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWL9
Fln msg: STOP codon was not found. Distance to subject end: 2 aas, your sequence is shorter than subject: 72 - 490
Fln protein:
H
Protein Length:
73
Fln nts:
T
Fln Alignment:
HLKU4M004I7MRH___HTPFFNNYRPQFYFRTTDVTGSISL-----PEGTEMVMPGDNISMTVKLIAPIAMEEGLRFAIREGGRTVGAGVV
A9NWL9________________HSPFFAGYRPQFYMRTTDVTGKVTAIMNDKDEESKMVMPGDRVKMVVELITAVACEQGMRFAIREGGKTVGAGVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain