UniGene Name: sp_v3.0_unigene151440
Length: 151 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene151440
A |
Ace file of the UniGene sp_v3.0_unigene151440 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin carrier protein n=3 Tax=Poaceae RepID=Q6YUS2_ORYSJ | - | - | 2.0e-10 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Ubiquitin carrier protein | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 0.0 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 0.0 | % | |
| Sma3 | Ubiquitin--protein ligase. | EC:6.3.2.19 | - | 9.897e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g16890; At1g36340; At1g64230; At1g78870; At2g16740; At3g08690; At3g08700; At4g27960; At5g41700; At5g53300; At5g56150; B0811B10.8; B1043F11.37; CHLREDRAFT_129070; CHLREDRAFT_152525; CHLREDRAFT_160028; Elr; F17F16.19; F17O14.16; F17O14.17; F22C12.2; F6I1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | UBC13-MMS2 complex | GO:0031372 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
| Sma3 | cell redox homeostasis | GO:0045454 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | HAD-superfamily hydrolase, subfamily IA, variant 3 | IPR006402 | - | 0.0 | - |
| Sma3 | Thioredoxin domain | IPR013766 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
| Sma3 | IPR017936 | - | 0.0 | - | |
| Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G16740.1 | UBC29 ubiquitin-conjugating enzyme 29 chr2:7267880-7268737 FORWARD LENGTH=148 | 5.0e-16 | 86% |
| RefSeq | Arabidopsis thaliana | NP_565391.1 | ubiquitin-conjugating enzyme E2 29 [Arabidopsis thaliana] | 6.0e-16 | 86% |
| RefSeq | Populus trichocarpa | XP_002305519.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 84% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NKT3
Fln msg: Distance to subject end: 22 aas, your sequence is shorter than subject: 50 - 148
Fln protein:
N
Protein Length:
51
Fln nts:
A
Fln Alignment:
HLKU4M004JQVXL___NINADGNICLDILKDSWSPAXXXXXXXXXXXXXXTDPNPDDPLVPEVAHL
A9NKT3________________NINSNGNICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHM

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)