UniGene Name: sp_v3.0_unigene151024
Length: 189 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene151024
A |
Ace file of the UniGene sp_v3.0_unigene151024 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Acetyl-CoA acetyltransferase, mitochondrial n=1 Tax=Osmerus mordax RepID=C1BKH1_OSMMO | - | - | 4.0e-16 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
| Sma3 | Acetyl-CoA acetyltransferase, mitochondrial, putative | - | - | 1.14e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Acetyl-CoA C-acetyltransferase. | EC:2.3.1.9 | - | 1.047e-23 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 1.047e-23 | % | |
| Sma3 | Synthesis and degradation of ketone bodies | 00072 | 1.047e-23 | % | |
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 1.047e-23 | % | |
| Sma3 | Lysine degradation | 00310 | 1.047e-23 | % | |
| Sma3 | Benzoate degradation | 00362 | 1.047e-23 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 1.047e-23 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 1.047e-23 | % | |
| Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 1.047e-23 | % | |
| Sma3 | Propanoate metabolism | 00640 | 1.047e-23 | % | |
| Sma3 | Butanoate metabolism | 00650 | 1.047e-23 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 1.047e-23 | % | |
| Sma3 | Terpenoid backbone biosynthesis | 00900 | 1.047e-23 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.047e-23 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.047e-23 | % |
| Source | Gene names |
|---|---|
| Sma3 | AACT; AACT1; AAT1; AT5G47720; AT5G48230; At5g47720; At5g48230; EMB1276; GSVIVT00010952001; GSVIVT00029076001; HbAACT; MIF21.12; Os01g0110400; OsI_00091; OsJ_00082; P0439B06.9; PHATRDRAFT_23913; POPTRDRAFT_652350; POPTRDRAFT_732472; RCOM_0860740; RCOM_1926 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | acetyl-CoA C-acetyltransferase activity | GO:0003985 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | isoprenoid biosynthetic process | GO:0008299 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
| Sma3 | Thiolase-like, subgroup | IPR016038 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G48230.2 | EMB1276, ACAT2 acetoacetyl-CoA thiolase 2 chr5:19552570-19555122 REVERSE LENGTH=403 | 5.0e-18 | 59% |
| RefSeq | Arabidopsis thaliana | NP_851154.1 | acetyl-CoA acetyltransferase, cytosolic 1 [Arabidopsis thaliana] | 6.0e-18 | 59% |
| RefSeq | Populus trichocarpa | XP_002320528.1 | predicted protein [Populus trichocarpa] | 3.0e-18 | 65% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PTK9
Fln msg: Distance to subject end: 24 aas, your sequence is shorter than subject: 62 - 404
Fln protein:
K
Protein Length:
63
Fln nts:
A
Fln Alignment:
HLKU4M004IWUXN___SDIDWWEINEAFAVVVLANIKLLGLDPTKVNPLGGGVAIGHPIGSSGSRIITTLV
C0PTK9________________SQIDYYEINEAFSVVALANQKILDLKPETVNVHGGAVSLGHPLGCSGARIMVTLL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)