UniGene Name: sp_v3.0_unigene150945
Length: 168 nt
![]() |
---|
>sp_v3.0_unigene150945
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Ribonucleoside-diphosphate reductase n=1 Tax=Flavobacterium johnsoniae UW101 RepID=A5FMM0_FLAJ1 | - | - | 1.0e-27 | 100% |
FL-Next | sp=Ribonucleoside-diphosphate reductase large subunit; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 65% |
Sma3 | Ribonucleoside-diphosphate reductase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonucleoside-diphosphate reductase. | EC:1.17.4.1 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 0.0 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 0.0 | % | |
Sma3 | Glutathione metabolism | 00480 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | 1E03; At2g21790; CHLREDRAFT_185583; F7D8.11; G9-2; GSVIVT00019349001; MICPUCDRAFT_31349; MICPUN_93299; NSG5; OJ1548_F12.14; OSJNBa0033B09.19; OSTLU_48569; Os02g0804900; Os06g0168600; OsI_09340; OsI_30411; OsJ_08774; OsJ_20270; Ot01g00100; P0680A03.40; PHA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ribonucleoside-diphosphate reductase complex | GO:0005971 | Cellular Component | 0.0 | - |
Sma3 | ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor | GO:0004748 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
Sma3 | deoxyribonucleoside triphosphate biosynthetic process | GO:0009202 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribonucleotide reductase large subunit, C-terminal | IPR000788 | - | 0.0 | - |
Sma3 | ATP-cone | IPR005144 | - | 0.0 | - |
Sma3 | Ribonucleoside-diphosphate reductase, alpha subunit | IPR013346 | - | 0.0 | - |
Sma3 | Ribonucleotide reductase large subunit, N-terminal | IPR013509 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G21790.1 | R1, RNR1, CLS8, ATRNR1 ribonucleotide reductase 1 chr2:9293529-9297580 FORWARD LENGTH=816 | 6.0e-20 | 65% |
RefSeq | Arabidopsis thaliana | NP_179770.1 | ribonucleoside-diphosphate reductase subunit M1 [Arabidopsis thaliana] | 7.0e-20 | 65% |
RefSeq | Populus trichocarpa | XP_002307143.1 | predicted protein [Populus trichocarpa] | 7.0e-20 | 65% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SJ20
Fln msg: Distance to subject end: 440 aas, your sequence is shorter than subject: 56 - 816
Fln protein:
E
Protein Length:
57
Fln nts:
G
Fln Alignment:
HLKU4M004JTDTZ___EEMRARDLFFAMWTSDLFMKRVQEDSTWTLMCPNECPGLYDVYGDEFEALYTDYE
Q9SJ20________________EEHRARDLFYALWLPDLFMERVQNNGQWSLFCPNEAPGLADCWGAEFETLYTKYE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain