SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene150668

Length: 382 nt

UniGene Fasta

>sp_v3.0_unigene150668
ATTAGAACGGTGGCCGAAGAAGTGTTTTCAATTCTGGGCCGCGAGCCGCTCATCGAGGTGGCTACCGAGCTTGAGAAGATCGCTCTGTCGGATCCGTACTTCAAGGAGCGCAAGCTGTATCCCAACGTCGACTTCTACTCAGGTCTTATCTACAAGGCGATGGGTTTCCCTACCGATTACTTCCCCGTGTTGTTCACGATTCCTCGTACTGCGGGTTGGCTCGCCCACTGGTCTGAGTTCATTGACGATCCCGAGAATCGCATTGTTCGCCCTCGTCAGGTGTACCTTGGATCTGGTATTCGCGATTACGTTCCGATCGCCAACCGTGTGGCGCTCACGTCGAAGAATATTGTCAGCGGTGTCACCGCTGAGTCCAAGCGCC

Ace file of the UniGene sp_v3.0_unigene150668

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Citrate synthase n=1 Tax=Perkinsus marinus ATCC 50983 RepID=C5M0P5_9ALVE	-	-	2.94273e-44	77%
FL-Next	sp=Citrate synthase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	66%
Sma3	Citrate synthase	-	-	6.006e-32	-

Source	ECs	Term	Type	e value	Identity
Sma3	Citrate (Si)-synthase.	EC:2.3.3.1	-	5.322e-18	-

Source	KEGGs	Term	e value	Identity
Sma3	Citrate cycle (TCA cycle)	00020	5.322e-18	%
Sma3	Glyoxylate and dicarboxylate metabolism	00630	5.322e-18	%
Sma3	Biosynthesis of phenylpropanoids	01061	5.322e-18	%
Sma3	Biosynthesis of terpenoids and steroids	01062	5.322e-18	%
Sma3	Biosynthesis of alkaloids derived from shikimate pathway	01063	5.322e-18	%
Sma3	Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid	01064	5.322e-18	%
Sma3	Biosynthesis of alkaloids derived from histidine and purine	01065	5.322e-18	%
Sma3	Biosynthesis of alkaloids derived from terpenoid and polyketide	01066	5.322e-18	%
Sma3	Biosynthesis of plant hormones	01070	5.322e-18	%
Sma3	Metabolic pathways	01100	5.322e-18	%
Sma3	Biosynthesis of secondary metabolites	01110	5.322e-18	%

Source	Gene names
Sma3	At2g42790; At3g58740; At3g58750; CHLREDRAFT_24263; CIS1; CIS2; CSY1; CSY2; CSY3; F7D19.21; GSVIVT00018944001; MICPUCDRAFT_20691; MICPUCDRAFT_54016; MICPUN_104822; MICPUN_96682; OJ1705_E12.26; OSTLU_37633; Os02g0232400; OsI_06467; OsJ_05993; Ot17g02320; PH

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	glyoxysome	GO:0009514	Cellular Component	-
Sma3	citrate (Si)-synthase activity	GO:0004108	Molecular Function	-
Sma3		GO:0008415	Molecular Function	-
Sma3	transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer	GO:0046912	Molecular Function	-
Sma3	glyoxylate cycle	GO:0006097	Biological Process	-
Sma3	tricarboxylic acid cycle	GO:0006099	Biological Process	-
Sma3	fatty acid beta-oxidation	GO:0006635	Biological Process	-
Sma3	cellular carbohydrate metabolic process	GO:0044262	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Citrate synthase-like	IPR002020	-	-
Sma3	Citrate synthase, type II	IPR010953	-	-
Sma3	Citrate synthase-like, large alpha subdomain	IPR016142	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G42790.1	CSY3 citrate synthase 3 chr2:17803132-17805991 REVERSE LENGTH=509	1.4013e-45	63%
RefSeq	Arabidopsis thaliana	NP_181807.1	citrate synthase 3 [Arabidopsis thaliana]	1.4013e-45	63%
RefSeq	Populus trichocarpa	XP_002322875.1	predicted protein [Populus trichocarpa]	0.0	62%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: D5AAX0

Fln msg: STOP codon was not found. Distance to subject end: 9 aas, your sequence is shorter than subject: 127 - 509

Fln protein: IRTVAEEVFSILGREPLIEVATELEKIALSDPYFKERKLYPNVDFYSGLIYKAMGFPTDYFPVLFTIPRTAGWLAHWSEFIDDPENRIVRPRQVYLGSGIRDYVPIANRVALTSKNIVSGVTAESKR

Protein Length: 128

Fln nts: ATTAGAACGGTGGCCGAAGAAGTGTTTTCAATTCTGGGCCGCGAGCCGCTCATCGAGGTGGCTACCGAGCTTGAGAAGATCGCTCTGTCGGATCCGTACTTCAAGGAGCGCAAGCTGTATCCCAACGTCGACTTCTACTCAGGTCTTATCTACAAGGCGATGGGTTTCCCTACCGATTACTTCCCCGTGTTGTTCACGATTCCTCGTACTGCGGGTTGGCTCGCCCACTGGTCTGAGTTCATTGACGATCCCGAGAATCGCATTGTTCGCCCTCGTCAGGTGTACCTTGGATCTGGTATTCGCGATTACGTTCCGATCGCCAACCGTGTGGCGCTCACGTCGAAGAATATTGTCAGCGGTGTCACCGCTGAGTCCAAGCGCC

Fln Alignment:

HLKU4M004IZBML___IRTVAEEVFSILGREPLIEVATELEKIALSDPYFKERKLYPNVDFYSGLIYKAMGFPTDYFPVLFTIPRTAGWLAHWSEFIDDPENRIVRPRQVYLGSGIRDYVPIANRVA
D5AAX0________________IRNLAEEVFSIVGRDPLIEVAVALERAALSDEYFIKRKLYPNVDFYSGLIYRALGFPTEFFPVLFAIPRMAGYLAHWKESLDDPDTKIMRPQQWYTGVWLRHYTPVNKREA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain