|
||||||
|
UniGene Name: sp_v3.0_unigene150597
Length: 144 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene150597
T |
|
Ace file of the UniGene sp_v3.0_unigene150597
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin family n=1 Tax=Ruminococcus albus 8 RepID=E9S7A1_RUMAL | - | - | 2.0e-13 | 95% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | Putative polyubiquitin | - | - | 5.096e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G03240; At2g36170; At4g02890; At4g05050; At4g05320; At5g20620; At5g37640; B1472F02.6; EgUbi; FUBI1; GUbB1; GUbB2; H0303G06.8; LOC_Os03g13170; LOC_Os03g15370; LgUBQ; MICPUCDRAFT_17541; MICPUCDRAFT_28921; MICPUCDRAFT_36384; MICPUCDRAFT_51948; MICPUN_6063 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | cytoskeleton | GO:0005856 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | translational elongation | GO:0006414 | Biological Process | 0.0 | - |
| Sma3 | protein modification process | GO:0006464 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin | IPR000626 | - | 0.0 | - |
| Sma3 | Ribosomal protein 60S | IPR001813 | - | 0.0 | - |
| Sma3 | Ribosomal protein L40e | IPR001975 | - | 0.0 | - |
| Sma3 | Ribosomal protein S27a | IPR002906 | - | 0.0 | - |
| Sma3 | Actin-like | IPR004000 | - | 0.0 | - |
| Sma3 | Actin, conserved site | IPR004001 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G52590.1 | UBQ1, EMB2167, ERD16, HAP4 ubiquitin extension protein 1 chr3:19505668-19506681 FORWARD LENGTH=128 | 3.0e-19 | 92% |
| RefSeq | Arabidopsis thaliana | NP_566969.1 | 60S ribosomal protein L40-2 [Arabidopsis thaliana] | 3.0e-19 | 92% |
| RefSeq | Populus trichocarpa | XP_002333648.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 92% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LP57
Fln msg: Distance to subject end: 61 aas, your sequence is shorter than subject: 47 - 128
Fln protein:
L
Protein Length:
48
Fln nts:
T
Fln Alignment:
HLKU4M004I6J85___VKQKITDKEGIPPDQQRLIFAGKQLEDNRTLADYNIQKES
B8LP57________________VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
