SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene150270

Length: 317 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene150270
AAGGCTTTCTTCCCAGGACTCGTCAAGTTTTTCTCTAGTGGACCTATTGTTGCTATGGTTTGGCAAGGAAAAGGTGTCATTGCTGGAGGCCGTAGACTCCTTGGTGCCACCAATCCTGACGACTCTGCTCCTGGAACTATCCGTGGAGACTTGTGTGTAGTTGTTGGTCGCAACATTTGCCACGGTTCTGATGGACCTGAATCCGCAAAAGACGAAATCAAGTTGTGGTTCGGAGAAAAAGAAGTAATCAACTGGCAATCTTGCGAAGACTCTTGGGTCTACGAAAGCAAATAAATATTCATTGAATTGTTGAAGAC

Ace file of the UniGene sp_v3.0_unigene150270 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	PREDICTED: similar to putative nucleoside diphosphate kinase n=1 Tax=Tribolium castaneum RepID=UPI0001758086	-	-	9.0e-34	70%
FL-Next	sp=Nucleoside diphosphate kinase; Pinus pinaster (Maritime pine).	-	-	0.0	59%
Sma3	Nucleoside diphosphate kinase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Nucleoside-diphosphate kinase.	EC:2.7.4.6	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Purine metabolism	00230	%
Sma3	Pyrimidine metabolism	00240	%
Sma3	Metabolic pathways	01100	%
Sma3	Biosynthesis of secondary metabolites	01110	%

Source	Gene names
Sma3	AT4G11010; At4g09320; At4g11010; At4g23900; At5g63310; Bc-NDPK1; Bc-NDPK3; BcNDK 2; BcNDK I; BcNDK III; CHLREDRAFT_58944; F25I24.220; F8M12.12; FAP103; GSVIVT00006748001; GSVIVT00010474001; GSVIVT00019061001; LOC_Os10g41410; MDC12.28; MICPUCDRAFT_20218; M

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	mitochondrial inner membrane	GO:0005743	Cellular Component	-
Sma3	mitochondrial intermembrane space	GO:0005758	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast stroma	GO:0009570	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	flagellum	GO:0019861	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	nucleoside diphosphate kinase activity	GO:0004550	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	GTP biosynthetic process	GO:0006183	Biological Process	-
Sma3	UTP biosynthetic process	GO:0006228	Biological Process	-
Sma3	CTP biosynthetic process	GO:0006241	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	response to UV	GO:0009411	Biological Process	-
Sma3	red, far-red light phototransduction	GO:0009585	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	red or far-red light signaling pathway	GO:0010017	Biological Process	-
Sma3	response to hydrogen peroxide	GO:0042542	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	e value	Identity
Sma3	Nucleoside diphosphate kinase	IPR001564	-	0.0	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G23900.1	Nucleoside diphosphate kinase family protein chr4:12424505-12426318 FORWARD LENGTH=237	2.0e-39	63%
RefSeq	Arabidopsis thaliana	NP_567690.1	nucleoside diphosphate kinase IV [Arabidopsis thaliana]	2.0e-39	63%
RefSeq	Populus trichocarpa	XP_002299472.1	predicted protein [Populus trichocarpa]	9.0e-39	61%

Full-Lengther Next Prediction

Fln status: C-terminus

Fln database: coniferopsida.fasta

Fln subject: Q8RVI6

Fln msg: your sequence is shorter than subject: 98 - 235

Fln protein: KAFFPGLVKFFSSGPIVAMVWQGKGVIAGGRRLLGATNPDDSAPGTIRGDLCVVVGRNICHGSDGPESAKDEIKLWFGEKEVINWQSCEDSWVYESK*

Protein Length: 99

Fln nts: AAGGCTTTCTTCCCAGGACTCGTCAAGTTTTTCTCTAGTGGACCTATTGTTGCTATGGTTTGGCAAGGAAAAGGTGTCATTGCTGGAGGCCGTAGACTCCTTGGTGCCACCAATCCTGACGACTCTGCTCCTGGAACTATCCGTGGAGACTTGTGTGTAGTTGTTGGTCGCAACATTTGCCACGGTTCTGATGGACCTGAATCCGCAAAAGACGAAATCAAGTTGTGGTTCGGAGAAAAAGAAGTAATCAACTGGCAATCTTGCGAAGACTCTTGGGTCTACGAAAGCAAATAA___ATATTCATTGAATTGTTGAAGAC

Fln Alignment:

HLKU4M004JJAI5___KAFFPGLVKFFSSGPIVAMVWQGKGVIAGGRRLLGATNPDDSAPGTIRGDLCVVVGRNICHGSDGPESAKDEIKLWFGEKEVINWQSCEDSWVY
Q8RVI6________________RPFFNGLCEFLSSGPVLAMVWEGQGVIKYGRKLIGATDPQNSEPGTIRGDLAIIVGRNIIHGSDGPETAKNEINLWFKPEELVNYAHNSEKWLY

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain