UniGene Name: sp_v3.0_unigene150039
Length: 208 nt
![]() |
---|
>sp_v3.0_unigene150039
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | R2R3-MYB transcription factor MYB11 [Picea glauca] | - | - | 1.0e-29 | 79% |
FL-Next | tr=R2R3-MYB transcription factor MYB12; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 77% |
Sma3 | MYB transcription factor | - | - | 1.49e-28 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_17; 46C02.19; AT4g21440; At1g06180; At1g08810; At1g08810/F22O13_32; At1g16490; At1g34670; At1g56160; At1g79180; At2g31180; At3g01140; At3g02940; At3g23250; At3g28910; At3g47600; At3g61250; At4g05100; At4g21440; At4g28110; At5g15310; At5g16770; AtMY |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | cell morphogenesis | GO:0000902 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | induced systemic resistance, ethylene mediated signaling pathway | GO:0009866 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | cell growth | GO:0016049 | Biological Process | 0.0 | - |
Sma3 | cuticle development | GO:0042335 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ketose-bisphosphate aldolase, class-II | IPR000771 | - | 0.0 | - |
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G02940.1 | MYB107, AtMYB107 myb domain protein 107 chr3:662141-663830 FORWARD LENGTH=321 | 2.0e-37 | 76% |
RefSeq | Arabidopsis thaliana | NP_186944.1 | myb domain protein 107 [Arabidopsis thaliana] | 3.0e-37 | 76% |
RefSeq | Populus trichocarpa | XP_002305647.1 | predicted protein [Populus trichocarpa] | 2.0e-39 | 80% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A5JYF6
Fln msg: Distance to subject end: 299 aas, atg_distance in limit (1-15): atg_distance = 2, your sequence is shorter than subject: 60 - 369
Fln protein:
M
Protein Length:
61
Fln nts:
T
Fln Alignment:
HLKU4M002D5XRJ___GRAPCCDRMGVKKGPWSPEEDRKLIDYIQKHGFGNWRAIPRQAGLLRCGKSCRLRWTNYLRPDLKRGS
A5JYF6________________GRAPCCDKMGVKKGPWTLDEDQILVSYINKHGHGNWRALPKQAGLLRCGKSCRLRWTNYLKPDIKRGN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain