SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene150037

Length: 139 nt

UniGene Fasta

>sp_v3.0_unigene150037
CCGAGATTTTAACCACGTCTTGACTACCATGAGAGGAACCAGAGGGTACTTGGCGCCGGAGTGGATTTCCGGTATGCCCATTACTGCCAAGGCCGATGTCTATAGCTTCGGCATGACGTTGCTGGAAATCATAGCCGGG

Ace file of the UniGene sp_v3.0_unigene150037

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	RecName: Full=G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2; AltName: Full=Receptor-like kinase 4; AltName: Full=S-domain-2 (SD2) receptor kinase 2; Short=SD2-2; Flags: Precursor gb\|AAA32858.1\| receptor-like protein kinase [Arabidops	-	-	2.0e-14	80%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	60%
Sma3	Putative S-domain receptor-like protein kinase	-	-	9.25e-16	-

Source	ECs	Term	Type	e value	Identity
Sma3	Non-specific protein-tyrosine kinase.	EC:2.7.10.2	-	1.054e-06	-

Source	Gene names
Sma3	17L07.5; AT4g00340; AT4g32300; A_IG005I10.19; At2g19130; At4g32300; At5g35370; B1099D03.46; B1099D03.51; B1423D04.25; DUPR11.18; F10M6.60; F5I10.19; F8B4.10; GSVIVT00000338001; GSVIVT00001735001; GSVIVT00003755001; GSVIVT00003758001; GSVIVT00016916001; GS

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	cell surface	GO:0009986	Cellular Component	-
Sma3	thylakoid membrane	GO:0042651	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	phospholipase C activity	GO:0004629	Molecular Function	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	plastoquinol--plastocyanin reductase activity	GO:0009496	Molecular Function	-
Sma3	2 iron, 2 sulfur cluster binding	GO:0051537	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	lipid metabolic process	GO:0006629	Biological Process	-
Sma3		GO:0007242	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	recognition of pollen	GO:0048544	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	GPCR, rhodopsin-like, 7TM	IPR000276	-	-
Sma3	Serine/threonine dehydratase, pyridoxal-phosphate-binding site	IPR000634	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Epidermal growth factor-like domain	IPR000742	-	-
Sma3	S-locus glycoprotein	IPR000858	-	-
Sma3	Phospholipase C, phosphatidylinositol-specific , X domain	IPR000909	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Bulb-type lectin domain	IPR001480	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3		IPR001899	-	-
Sma3	PAN-1 domain	IPR003014	-	-
Sma3	Long hematopoietin receptor, Gp130 family 2, conserved site	IPR003529	-	-
Sma3	Apple-like	IPR003609	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3		IPR005806	-	-
Sma3	Epidermal growth factor-like	IPR006210	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	PAN-2 domain	IPR013227	-	-
Sma3	Cytochrome b6-f complex Fe-S subunit	IPR014909	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Rieske [2Fe-2S] iron-sulphur domain	IPR017941	-	-
Sma3	Peptidase S26A, signal peptidase I, serine active site	IPR019756	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G00340.1	RLK4 receptor-like protein kinase 4 chr4:148958-151496 FORWARD LENGTH=818	2.0e-19	80%
RefSeq	Arabidopsis thaliana	NP_567172.4	receptor-like protein kinase 4 [Arabidopsis thaliana]	2.0e-19	80%
RefSeq	Populus trichocarpa	XP_002319936.1	predicted protein [Populus trichocarpa]	2.0e-21	80%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NM60

Fln msg: Distance to subject end: 122 aas, your sequence is shorter than subject: 46 - 431

Fln protein: RDFNHVLTTMRGTRGYLAPEWISGMPITAKADVYSFGMTLLEIIAG

Protein Length: 47

Fln nts: CCGAGATTTTAACCACGTCTTGACTACCATGAGAGGAACCAGAGGGTACTTGGCGCCGGAGTGGATTTCCGGTATGCCCATTACTGCCAAGGCCGATGTCTATAGCTTCGGCATGACGTTGCTGGAAATCATAGCCGGG

Fln Alignment:

HLKU4M002C5QOW___NHVLTTMRGTRGYLAPEWISGMPITAKADVYSFGMTLLEIIAG
A9NM60________________SHLVTGVRGTPGYMAPEWLLGAGITSKSDVFSYGMVLLEIISG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain