UniGene Name: sp_v3.0_unigene150037
Length: 139 nt
![]() |
---|
>sp_v3.0_unigene150037
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2; AltName: Full=Receptor-like kinase 4; AltName: Full=S-domain-2 (SD2) receptor kinase 2; Short=SD2-2; Flags: Precursor gb|AAA32858.1| receptor-like protein kinase [Arabidops | - | - | 2.0e-14 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | Putative S-domain receptor-like protein kinase | - | - | 9.25e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.054e-06 | - |
Source | Gene names |
---|---|
Sma3 | 17L07.5; AT4g00340; AT4g32300; A_IG005I10.19; At2g19130; At4g32300; At5g35370; B1099D03.46; B1099D03.51; B1423D04.25; DUPR11.18; F10M6.60; F5I10.19; F8B4.10; GSVIVT00000338001; GSVIVT00001735001; GSVIVT00003755001; GSVIVT00003758001; GSVIVT00016916001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | thylakoid membrane | GO:0042651 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | phospholipase C activity | GO:0004629 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | plastoquinol--plastocyanin reductase activity | GO:0009496 | Molecular Function | 0.0 | - |
Sma3 | 2 iron, 2 sulfur cluster binding | GO:0051537 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | GO:0007242 | Biological Process | 0.0 | - | |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G00340.1 | RLK4 receptor-like protein kinase 4 chr4:148958-151496 FORWARD LENGTH=818 | 2.0e-19 | 80% |
RefSeq | Arabidopsis thaliana | NP_567172.4 | receptor-like protein kinase 4 [Arabidopsis thaliana] | 2.0e-19 | 80% |
RefSeq | Populus trichocarpa | XP_002319936.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 80% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 122 aas, your sequence is shorter than subject: 46 - 431
Fln protein:
R
Protein Length:
47
Fln nts:
C
Fln Alignment:
HLKU4M002C5QOW___NHVLTTMRGTRGYLAPEWISGMPITAKADVYSFGMTLLEIIAG
A9NM60________________SHLVTGVRGTPGYMAPEWLLGAGITSKSDVFSYGMVLLEIISG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain