UniGene Name: sp_v3.0_unigene149999
Length: 144 nt
![]() |
---|
>sp_v3.0_unigene149999
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative phosphate transporter n=1 Tax=Cryptomeria japonica RepID=Q1XG57_CRYJA | - | - | 3.0e-18 | 93% |
FL-Next | tr=Putative phosphate transporter; Cryptomeria japonica (Japanese cedar) (Cupressus japonica). | - | - | 0.0 | 93% |
Sma3 | Phosphate transporter | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | 5K14.7; APT1; APT2; At1g20860; At1g76430; At2g32830; At2g38940; At3g54700; At5g43340; At5g43350; At5g43360; At5g43370; EcPT1; EcPT2; EdPT1; F14G6.3; F15M4.7; F24L7.3; F9H16.16; GSVIVT00002927001; GSVIVT00006480001; GSVIVT00006481001; GSVIVT00020254001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | inorganic phosphate transmembrane transporter activity | GO:0005315 | Molecular Function | 0.0 | - |
Sma3 | symporter activity | GO:0015293 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | phosphate ion transport | GO:0006817 | Biological Process | 0.0 | - |
Sma3 | cellular response to phosphate starvation | GO:0016036 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
Sma3 | Phosphate permease | IPR004738 | - | 0.0 | - |
Sma3 | General substrate transporter | IPR005828 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase | IPR006186 | - | 0.0 | - |
Sma3 | Major facilitator superfamily | IPR011701 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G54700.1 | " PHT1;7 phosphate transporter 1;7 chr3:20248463-20250070 REVERSE LENGTH=535" | 3.0e-23 | 89% |
RefSeq | Arabidopsis thaliana | NP_191030.3 | putative inorganic phosphate transporter 1-7 [Arabidopsis thaliana] | 4.0e-23 | 89% |
RefSeq | Populus trichocarpa | XP_002315705.1 | high affinity inorganic phosphate transporter [Populus trichocarpa] | 2.0e-23 | 91% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q1XG57
Fln msg: Distance to subject end: 386 aas, your sequence is shorter than subject: 47 - 544
Fln protein:
S
Protein Length:
48
Fln nts:
T
Fln Alignment:
HLKU4M002EXOLL___SLASGLSFGSTAKSVMTTLCFFRFWLGFGIGGDYPLSATIMSEYASK
Q1XG57________________SIASGLSFGHTAKSVMTTLCFFRFWLGFGIGGDYPLSATIMSEYANK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain