UniGene Name: sp_v3.0_unigene149949
Length: 221 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene149949
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Os02g0151000 protein n=3 Tax=Oryza sativa RepID=Q67UW7_ORYSJ | - | - | 8.0e-20 | 58% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
Sma3 | EMB2261 putative | - | - | 6.002e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g15510; At2g01510; At4g21300; At5g48910; F2I9.13; GSVIVT00000138001; GSVIVT00004379001; GSVIVT00006499001; GSVIVT00006516001; GSVIVT00007631001; GSVIVT00007922001; GSVIVT00011396001; GSVIVT00013634001; GSVIVT00015640001; GSVIVT00016451001; GSVIVT000164 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Nuclear control of ATP synthase 2 | IPR013946 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G13600.1 | Pentatricopeptide repeat (PPR) superfamily protein chr2:5671493-5673586 FORWARD LENGTH=697 | 2.0e-22 | 53% |
RefSeq | Arabidopsis thaliana | NP_178983.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-22 | 53% |
RefSeq | Populus trichocarpa | XP_002320193.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 58% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5A804
Fln msg: Distance to subject end: 174 aas, your sequence is shorter than subject: 72 - 246
Fln protein:
M
Protein Length:
73
Fln nts:
T
Fln Alignment:
HLKU4M002DC3CE___MTGDYGITPGVDHYACMVDLLGRMGLMTEAEDFIKSMPLHPDPVVWKALLGACAVHRNLEVGERVAKELFKL
D5A804________________MSQNYGIEPRVKHYACMVDILGRAGCLDEAHDFISNMPLEPDDGVWGALLGACKIHLNIELAECVAEHLFKL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain