UniGene Name: sp_v3.0_unigene149924
Length: 216 nt
![]() |
---|
>sp_v3.0_unigene149924
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Integrase n=1 Tax=Boechera divaricarpa RepID=B6REL8_9BRAS | - | - | 2.0e-18 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 57% |
Sma3 | Retrotransposon protein, putative, unclassified | - | - | 2.781e-14 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_33; At2g05960; At2g15650; B1110B01.4; F11I4_21; F28G4.2; F28H19.6; LOC_Os03g05850; LOC_Os03g26290; LOC_Os03g26570; LOC_Os03g28110; LOC_Os03g47410; LOC_Os03g56530; LOC_Os03g61660; LOC_Os10g01750; LOC_Os10g04074; LOC_Os10g17570; LOC_Os10g26030; LOC_O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | potassium ion transmembrane transporter activity | GO:0015079 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | rRNA N-glycosylase activity | GO:0030598 | Molecular Function | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | negative regulation of translation | GO:0017148 | Biological Process | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Distance to subject end: 125 aas, your sequence is shorter than subject: 71 - 407
Fln protein:
A
Protein Length:
72
Fln nts:
C
Fln Alignment:
HLKU4M002EQT6E___FTNFCDTHGIKRQLTTPYTPQQNSVVERCNRTVVEMARSMLQHRSVPNKFWAEAVFIVVYLLNRSPTQAV
B8LKX7________________FDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain