|
||||||
|
UniGene Name: sp_v3.0_unigene149922
Length: 172 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene149922
T |
|
Ace file of the UniGene sp_v3.0_unigene149922
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peroxidase (Fragment) n=1 Tax=Spinacia oleracea RepID=O49943_SPIOL | - | - | 9.0e-18 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
| Sma3 | Putative peroxidase | - | - | 9.171e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At4g16270; At4g33420; At5g42180; At5g51890; B1135C02.43; FCAALL.329; GSVIVT00003644001; GSVIVT00004228001; GSVIVT00011734001; GSVIVT00013661001; GSVIVT00015486001; GSVIVT00022533001; GSVIVT00022535001; GSVIVT00022537001; GSVIVT00026051001; GSVIVT000260520 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G51890.1 | Peroxidase superfamily protein chr5:21091163-21092335 REVERSE LENGTH=322 | 2.0e-22 | 70% |
| RefSeq | Arabidopsis thaliana | NP_200002.3 | peroxidase 66 [Arabidopsis thaliana] | 2.0e-22 | 70% |
| RefSeq | Populus trichocarpa | XP_002300689.1 | predicted protein [Populus trichocarpa] | 4.0e-20 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NLP5
Fln msg: Distance to subject end: 36 aas, your sequence is shorter than subject: 57 - 169
Fln protein:
C
Protein Length:
58
Fln nts:
T
Fln Alignment:
HLKU4M002C5ZEQ___CDASVLLDSTITPKNEAEKDGPPNVSLRAFYVIDDAKTKIESICPQTVSCADILAI
A9NLP5________________CDASLLVDSTAG--NQAEKEAGPNQTVRGFEFIDEMKKVLETVCPNTVSCADIIAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
