UniGene Name: sp_v3.0_unigene149834
Length: 230 nt
![]() |
---|
>sp_v3.0_unigene149834
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SY02.1|PP301_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02750 gb|AAD15348.1| hypothetical protein [Arabidopsis thaliana] emb|CAB77760.1| hypothetical protein | - | - | 1.0e-18 | 53% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Source | Gene names |
---|---|
Sma3 | At4g02750; At4g13650; At5g39350; F18A5.40; GSVIVT00000887001; GSVIVT00001706001; GSVIVT00003060001; GSVIVT00004379001; GSVIVT00005103001; GSVIVT00006467001; GSVIVT00006516001; GSVIVT00006853001; GSVIVT00006945001; GSVIVT00007631001; GSVIVT00007922001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Serine/threonine dehydratase, pyridoxal-phosphate-binding site | IPR000634 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Mannose-binding lectin | IPR001229 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 8.0e-24 | 53% |
RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-23 | 53% |
RefSeq | Populus trichocarpa | XP_002302563.1 | predicted protein [Populus trichocarpa] | 9.0e-25 | 57% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 127 aas, your sequence is shorter than subject: 76 - 246
Fln protein:
A
Protein Length:
77
Fln nts:
G
Fln Alignment:
HLKU4M002ELM8I___ALVWGTLLGACRIYNNVELGKRVAENIFELEPQASATYVLLSNIYAAAGRWDDVAKIRTTMLERGIRKEPGHSQIE
D5AAE0________________ANVWGALLGACRMYGNIDLGKHAAECLFQLEPHNAAKYVLLSNIYAAAGRWDDVAKVRKIMKDRGVQKQPGCSWIE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain