|
||||||
|
UniGene Name: sp_v3.0_unigene149590
Length: 116 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene149590
G |
|
Ace file of the UniGene sp_v3.0_unigene149590
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Sucrose synthase n=1 Tax=Pinus taeda RepID=A6N837_PINTA | - | - | 4.0e-13 | 94% |
| FL-Next | tr=Sucrose synthase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 94% |
| Sma3 | Sucrose synthase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase. | EC:2.4.1.13 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g43190; At4g02280; At5g20830; At5g49190; B1056G08.118; CSS1; CitSUSA; CitSUSA-2; F7K15_40; GSVIVT00016378001; GSVIVT00028036001; GSVIVT00033041001; K21P3.6; LOC_Os03g22120; LOC_Os03g28330; LOC_Os06g09450; LOC_Os07g42490; LpSUS; Os03g0340500; Os03g04013 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | sucrose synthase activity | GO:0016157 | Molecular Function | 0.0 | - |
| Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
| Sma3 | sucrose metabolic process | GO:0005985 | Biological Process | 0.0 | - |
| Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
| Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to flooding | GO:0009413 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Sucrose synthase | IPR000368 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 1 | IPR001296 | - | 0.0 | - |
| Sma3 | Sucrose synthase, plant/cyanobacteria | IPR012820 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G49190.1 | SUS2, SSA, ATSUS2 sucrose synthase 2 chr5:19943369-19947189 REVERSE LENGTH=807 | 2.0e-13 | 75% |
| RefSeq | Arabidopsis thaliana | NP_199730.1 | sucrose synthase 2 [Arabidopsis thaliana] | 3.0e-13 | 75% |
| RefSeq | Populus trichocarpa | XP_002302727.1 | predicted protein [Populus trichocarpa] | 4.0e-12 | 71% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A6N837
Fln msg: Distance to subject end: 277 aas, your sequence is shorter than subject: 38 - 833
Fln protein:
I
Protein Length:
39
Fln nts:
G
Fln Alignment:
HIF1XHV02ELKO6___PSYNIVSPGADMQIYFPYTEKQHRLTALHGTIEELLF
A6N837________________PKFNIVSPGADMQIYFPYTEKQHRLTALHGTIEELLF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
