UniGene Name: sp_v3.0_unigene149581
Length: 195 nt
![]() |
---|
>sp_v3.0_unigene149581
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP-dependent Clp protease proteolytic subunit n=1 Tax=Picea sitchensis RepID=A9NSF5_PICSI | - | - | 2.0e-28 | 96% |
FL-Next | sp=ATP-dependent Clp protease proteolytic subunit; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | ATP-dependent Clp protease proteolytic subunit | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Endopeptidase Clp. | EC:3.4.21.92 | - | 8.193e-14 | - |
Source | Gene names |
---|---|
Sma3 | At1g02560; At5g23140; CHLREDRAFT_196557; CHLREDRAFT_55336; CLP1; CLPP2; CLPP5; ClpP2a; ClpP4; GSVIVT00028120001; MICPUCDRAFT_55668; MICPUN_112702; MYJ24.13; NCLPP1; NCLPP5; NCLPP7; OJ1643_A10.30; OSIGBa0153E02-OSIGBa0093I20.20; OSJNBa0038O10.7; OSTLU_1538 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid | GO:0009534 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplastic endopeptidase Clp complex | GO:0009840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Peptidase S14, ClpP | IPR001907 | - | 0.0 | - |
Sma3 | Trigger factor, C-terminal, bacterial | IPR008880 | - | 0.0 | - |
Sma3 | Acute myeloid leukemia 1 (AML 1)/Runt | IPR013524 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Peptidase S14, ClpP, active site | IPR018215 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G23140.1 | CLPP2, NCLPP7 nuclear-encoded CLP protease P7 chr5:7783811-7784826 FORWARD LENGTH=241 | 1.0e-20 | 58% |
RefSeq | Arabidopsis thaliana | NP_568427.1 | ATP-dependent Clp protease proteolytic subunit 2 [Arabidopsis thaliana] | 2.0e-20 | 58% |
RefSeq | Populus trichocarpa | XP_002310077.1 | predicted protein [Populus trichocarpa] | 8.0e-21 | 58% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NSF5
Fln msg: Distance to subject end: 37 aas, your sequence is shorter than subject: 65 - 243
Fln protein:
R
Protein Length:
66
Fln nts:
A
Fln Alignment:
HIF1XHV02EHAXX___RRSLPNARIMVHQPSGGASGQASDIAIQAKEILLTRDRLNSLYAKHTGQSIEKIEKCMERDMFMS
A9NSF5________________RRSLPNARIMIHQPSGGASGQASDIAIQAKEILLTRDRLNSLYAKHTGQSIDKIEKCMERDMFMS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain