|
||||||
|
UniGene Name: sp_v3.0_unigene149569
Length: 207 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene149569
G |
|
Ace file of the UniGene sp_v3.0_unigene149569 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pol protein integrase region (Fragment) n=1 Tax=Pinus brutia RepID=Q9M6N4_9CONI | - | - | 1.0e-28 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 61% |
| Sma3 | Pol protein integrase region | - | - | 9.23456e-42 | - |
| Source | Gene names |
|---|---|
| Sma3 | F23H6.1; H0321H01.8; LOC_Os10g28310; LOC_Os11g20270; LOC_Os11g32060; LOC_Os11g45000; LOC_Os11g45200; LOC_Os11g45920; LOC_Os12g18080; LOC_Os12g43850; MtrDRAFT_AC150244g37v2; OSIGBa0096P03.5; OSJNBa0013A04.20; OSJNBa0042F15.18; OSJNBa0053B21.10; OSJNBa0060G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | carbonate dehydratase activity | GO:0004089 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Sma3 | carbon utilization | GO:0015976 | Biological Process | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5AP28
Fln msg: Distance to subject end: 284 aas, your sequence is shorter than subject: 69 - 647
Fln protein:
D
Protein Length:
70
Fln nts:
G
Fln Alignment:
HIF1XHV02DL7NA___DRLSKYAHFCALPHPFTPTLVAQSFMDQIFKLHGMPTYIVSDRDPIFTSNFLPELFRIQGTQLKLSTS
A5AP28________________DRLSKSAHFLALTHPFSAKMVAEKFVDGVIKLHGMPSSIISDRDPIFISNFWHEFFKLSGTQLKMSSA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
