UniGene Name: sp_v3.0_unigene149538
Length: 100 nt
UniGene Fasta |
---|
>sp_v3.0_unigene149538
A |
Ace file of the UniGene sp_v3.0_unigene149538 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | CLV1-like LRR receptor kinase n=1 Tax=Silene latifolia RepID=D3KTY9_SILLA | - | - | 2.0e-08 | 78% |
FL-Next | tr=Clavata-like receptor; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 81% |
Sma3 | Leucine-rich repeat receptor-like protein kinase | - | - | 2.123e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.709e-08 | - |
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.961e-12 | - |
Source | Gene names |
---|---|
Sma3 | AT1G75820; AT2G33170; AT3G49670; AT4G28490; AT5G63930; AT5G65700; At1g17230; At1g17230/F20D23_7; At1g75820; At2g33170; At3g49670; At4g28490; At5g63930; At5g65700; CLAVATA1; CLL1A; CLL1B; CLL3; CLV; CLV1; CLV1A; CLV1B; CM0216.560.nc; F20D23.7; F21O9.180; F |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
Sma3 | regulation of meristem growth | GO:0010075 | Biological Process | 0.0 | - |
Sma3 | microsporocyte differentiation | GO:0010480 | Biological Process | 0.0 | - |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Sma3 | gametophyte development | GO:0048229 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Enolpyruvate transferase domain | IPR001986 | - | 0.0 | - |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
Sma3 | Aminotransferases, class-I, pyridoxal-phosphate-binding site | IPR004838 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Sma3 | Interleukin-4/interleukin-13, conserved site | IPR018096 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G75820.1 | CLV1, FAS3, FLO5, ATCLV1 Leucine-rich receptor-like protein kinase family protein chr1:28463631-28466652 REVERSE LENGTH=980 | 3.0e-12 | 78% |
RefSeq | Arabidopsis thaliana | NP_177710.1 | receptor protein kinase CLAVATA1 [Arabidopsis thaliana] | 3.0e-12 | 78% |
RefSeq | Populus trichocarpa | XP_002300697.1 | predicted protein [Populus trichocarpa] | 2.0e-12 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q19AV8
Fln msg: Distance to subject end: 157 aas, your sequence is shorter than subject: 32 - 998
Fln protein:
L
Protein Length:
33
Fln nts:
A
Fln Alignment:
HIF1XHV02D2LXS___LHHDCEPSIVHRDIKSNNILLDEDCDAHVADF
Q19AV8________________LHHGCVPAIVHRDVKSNNILLDEDYVAHVADF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain