UniGene Name: sp_v3.0_unigene149483
Length: 210 nt
![]() |
---|
>sp_v3.0_unigene149483
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Probable aldehyde oxidase 1; Short=AO-1 gb|AAL70116.1|AC099733_7 Putative aldehyde oxidase [Oryza sativa] gb|AAP52052.1| Aldehyde oxidase 1, putative, expressed [Oryza sativa Japonica Group] gb|EAZ15246.1| hypothetical protein OsJ_30665 [Ory | - | - | 3.0e-10 | 90% |
FL-Next | sp=Probable aldehyde oxidase 1; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 90% |
Sma3 | Aldehyde oxidase, putative | - | - | 8.127e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde oxidase. | EC:1.2.3.1 | - | 7.628e-22 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 7.628e-22 | % | |
Sma3 | Tyrosine metabolism | 00350 | 7.628e-22 | % | |
Sma3 | Tryptophan metabolism | 00380 | 7.628e-22 | % | |
Sma3 | Vitamin B6 metabolism | 00750 | 7.628e-22 | % | |
Sma3 | Nicotinate and nicotinamide metabolism | 00760 | 7.628e-22 | % | |
Sma3 | Drug metabolism - cytochrome P450 | 00982 | 7.628e-22 | % | |
Sma3 | Metabolic pathways | 01100 | 7.628e-22 | % | |
Sma3 | Abscisic-aldehyde oxidase. | EC:1.2.3.14 | - | 4.842e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Carotenoid biosynthesis | 00906 | 4.842e-08 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 4.842e-08 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 4.842e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 4.842e-08 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.842e-08 | % |
Source | Gene names |
---|---|
Sma3 | AAO1; AAO2; AAO3; AO2; AO3; AO4; At2g27150; F20F1.2; GSVIVT00017483001; LOC_Os03g57680; LOC_Os03g57690; LOC_Os10g04860; LsAO1; OSJNAa0087H07.7; OSJNBa0087O09.19; Os03g0790700; Os03g0790900; Os07g0164900; Os10g0138100; OsI_13843; OsI_13844; OsI_13851; OsI_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | aldehyde oxidase activity | GO:0004031 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | abscisic aldehyde oxidase activity | GO:0010293 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | molybdenum ion binding | GO:0030151 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | indole-3-acetaldehyde oxidase activity | GO:0050302 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
Sma3 | 2 iron, 2 sulfur cluster binding | GO:0051537 | Molecular Function | 0.0 | - |
Sma3 | abscisic acid biosynthetic process | GO:0009688 | Biological Process | 0.0 | - |
Sma3 | auxin biosynthetic process | GO:0009851 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Oxidoreductase, molybdopterin-binding domain | IPR000572 | - | 0.0 | - |
Sma3 | Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead | IPR000674 | - | 0.0 | - |
Sma3 | 2Fe-2S ferredoxin-type domain | IPR001041 | - | 0.0 | - |
Sma3 | Molybdopterin dehydrogenase, FAD-binding | IPR002346 | - | 0.0 | - |
Sma3 | [2Fe-2S]-binding | IPR002888 | - | 0.0 | - |
Sma3 | CO dehydrogenase flavoprotein, C-terminal | IPR005107 | - | 0.0 | - |
Sma3 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR006058 | - | 0.0 | - |
Sma3 | Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding | IPR008274 | - | 0.0 | - |
Sma3 | Beta-grasp domain | IPR012675 | - | 0.0 | - |
Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
Sma3 | CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 | IPR016169 | - | 0.0 | - |
Sma3 | Aldehyde oxidase/xanthine dehydrogenase | IPR016208 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G27150.1 | AAO3, At-AO3, AOdelta, AtAAO3 abscisic aldehyde oxidase 3 chr2:11601952-11607014 FORWARD LENGTH=1332 | 5.0e-11 | 75% |
RefSeq | Arabidopsis thaliana | NP_180283.1 | abscisic-aldehyde oxidase [Arabidopsis thaliana] | 7.0e-11 | 75% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q7XH05
Fln msg: Distance to subject end: 457 aas, your sequence is shorter than subject: 70 - 1358
Fln protein:
C
Protein Length:
71
Fln nts:
T
Fln Alignment:
HIF1XHV02C4K85___CAVAAYKLRQPVRMYLDRKTDMIMAGGRHPIKA
Q7XH05________________CAVAAFKLRRPVRMYLDRKTDMIMAGGRHPMKA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain