UniGene Name: sp_v3.0_unigene149424
Length: 154 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene149424
T |
Ace file of the UniGene sp_v3.0_unigene149424
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide, putative [Oryza sativa Japonica Group] gb|EAZ26719.1| hypothetical protein OsJ_10627 [Oryza sativa Japonica Group] | - | - | 5.0e-13 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Tetratricopeptide-like helical | - | - | 1.61e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g15510; At2g22070; At3g11460; At3g46790; At4g02750; At4g16835; At4g21300; At5g08510; At5g44230; At5g59600; At5g66520; B1032F05.19; CRR2; DYW10; F24K9.13; F2O15.13; F8L15.21; FCAALL.441; GSVIVT00000293001; GSVIVT00000887001; GSVIVT00002188001; GSVIVT000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF629 | IPR006865 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF627, N-terminal | IPR006866 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 3.0e-17 | 69% |
| RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 4.0e-17 | 69% |
| RefSeq | Populus trichocarpa | XP_002327523.1 | predicted protein [Populus trichocarpa] | 4.0e-19 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 178 aas, your sequence is shorter than subject: 50 - 795
Fln protein:
V
Protein Length:
51
Fln nts:
T
Fln Alignment:
HIF1XHV02D81KH___VDLLGRAGHLDEAHEIIKNMPLEPDAVVWGCLLGACRIHCNIELAEEAAR
B8LQA8________________VDLLGRAGHLDEANGIIKNMSLEPDANVWGALLGACRIHCNIELGEQAAK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta