SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene149345

Length: 218 nt

UniGene Fasta

>sp_v3.0_unigene149345
GTTCTTGAAGCCTTTGGTAACGCCAAAACTGTCAGAAACAACAATTCCAGTCGTTTTGGGAAATTTGTGGAGCTTCAGTTCGACAAGACTGGGAGGATATCAGGAGCTGCTGTGAGAACCTACCTTCTAGAAAGGTCCCGTGTCTGTCAACTTTCAGATCCAGAAAGAAATTATCATTGCTTTTACCTACTTTGCGCCGCTCCGCCTGAGGATATTAA

Ace file of the UniGene sp_v3.0_unigene149345

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	F1L3.28 n=1 Tax=Arabidopsis thaliana RepID=Q9LNP7_ARATH	-	-	1.0e-33	93%
FL-Next	tr=Putative uncharacterized protein; Vitis vinifera (Grape).	-	-	0.0	90%
Sma3	Myosin XI	-	-	2.485e-27	-

Source	Gene names
Sma3	AT4g27370; AT4g28710; AT4g33200; ATM; At1g17580; At1g50360; At2g20290; At2g31900; At2g33240; At3g19960; At3g58160; At4g27370; At4g33200; At5g20490; At5g43900; At5g54280; CHLREDRAFT_113760; CHLREDRAFT_185104; CpMXIa(N65); CpMXIa(N67/ 68); CpMXIb(N65); CpMX

Source	GOs	Term	Type	Identity
Sma3	chromosome	GO:0005694	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	Golgi apparatus	GO:0005794	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	cell plate	GO:0009504	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	myosin complex	GO:0016459	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	motor activity	GO:0003774	Molecular Function	-
Sma3	actin binding	GO:0003779	Molecular Function	-
Sma3	5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity	GO:0003871	Molecular Function	-
Sma3	DNA topoisomerase type I activity	GO:0003917	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	signal transducer activity	GO:0004871	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3		GO:0047210	Molecular Function	-
Sma3	actin filament binding	GO:0051015	Molecular Function	-
Sma3	DNA topological change	GO:0006265	Biological Process	-
Sma3	DNA unwinding involved in replication	GO:0006268	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	methionine biosynthetic process	GO:0009086	Biological Process	-
Sma3	actin filament-based movement	GO:0030048	Biological Process	-
Sma3	cellulose biosynthetic process	GO:0030244	Biological Process	-
Sma3	keratinization	GO:0031424	Biological Process	-
Sma3		GO:0045449	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3	Ribosomal protein S7	IPR000235	-	-
Sma3	Involucrin repeat	IPR000354	-	-
Sma3	DNA topoisomerase, type IA	IPR000380	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site	IPR001216	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	Pyridoxal phosphate-dependent enzyme, beta subunit	IPR001926	-	-
Sma3	Methionine synthase, vitamin-B12 independent	IPR002629	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Immunoglobulin/major histocompatibility complex, conserved site	IPR003006	-	-
Sma3	No apical meristem (NAM) protein	IPR003441	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	DNA topoisomerase, type IA, domain 2	IPR003601	-	-
Sma3	HAMP linker domain	IPR003660	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	Alpha-1,4-glucan-protein synthase, UDP-forming	IPR004901	-	-
Sma3	Kinetochore protein Ndc80	IPR005550	-	-
Sma3	Cysteine synthase K/M	IPR005856	-	-
Sma3	Cysteine synthase A	IPR005859	-	-
Sma3		IPR006154	-	-
Sma3	Toprim domain	IPR006171	-	-
Sma3	Zinc finger, C2H2	IPR007087	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Root hair defective 3 GTP-binding	IPR008803	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	DNA topoisomerase, type IA, central	IPR013497	-	-
Sma3	DNA topoisomerase, type IA, central region, subdomain 3	IPR013826	-	-
Sma3	Beta tubulin, autoregulation binding site	IPR013838	-	-
Sma3	Zinc finger, C2H2-like	IPR015880	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	Dil domain	IPR018444	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G17580.1	MYA1, ATMYA1, XI-1 myosin 1 chr1:6039453-6049309 FORWARD LENGTH=1520	3.00004e-41	93%
RefSeq	Arabidopsis thaliana	NP_173201.2	myosin 1 [Arabidopsis thaliana]	4.00001e-41	93%
RefSeq	Populus trichocarpa	XP_002302064.1	predicted protein [Populus trichocarpa]	1.99993e-41	88%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: A5B1K8

Fln msg: Distance to subject end: 230 aas, your sequence is shorter than subject: 72 - 357

Fln protein: VLEAFGNAKTVRNNNSSRFGKFVELQFDKTGRISGAAVRTYLLERSRVCQLSDPERNYHCFYLLCAAPPEDI

Protein Length: 73

Fln nts: GTTCTTGAAGCCTTTGGTAACGCCAAAACTGTCAGAAACAACAATTCCAGTCGTTTTGGGAAATTTGTGGAGCTTCAGTTCGACAAGACTGGGAGGATATCAGGAGCTGCTGTGAGAACCTACCTTCTAGAAAGGTCCCGTGTCTGTCAACTTTCAGATCCAGAAAGAAATTATCATTGCTTTTACCTACTTTGCGCCGCTCCGCCTGAGGATATTAA

Fln Alignment:

HIF1XHV02DCGIT___VLEAFGNAKTVRNNNSSRFGKFVELQFDKTGRISGAAVRTYLLERSRVCQLSDPERNYHCFYLLCAAPPEDI
A5B1K8________________VLEAFGNAKTVRNNNSSRFGKFVEIQFDQRGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAAPPEDV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain