UniGene Name: sp_v3.0_unigene149345
Length: 218 nt
![]() |
---|
>sp_v3.0_unigene149345
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | F1L3.28 n=1 Tax=Arabidopsis thaliana RepID=Q9LNP7_ARATH | - | - | 1.0e-33 | 93% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 90% |
Sma3 | Myosin XI | - | - | 2.485e-27 | - |
Source | Gene names |
---|---|
Sma3 | AT4g27370; AT4g28710; AT4g33200; ATM; At1g17580; At1g50360; At2g20290; At2g31900; At2g33240; At3g19960; At3g58160; At4g27370; At4g33200; At5g20490; At5g43900; At5g54280; CHLREDRAFT_113760; CHLREDRAFT_185104; CpMXIa(N65); CpMXIa(N67/ 68); CpMXIb(N65); CpMX |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell plate | GO:0009504 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity | GO:0003871 | Molecular Function | 0.0 | - |
Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | GO:0047210 | Molecular Function | 0.0 | - | |
Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | methionine biosynthetic process | GO:0009086 | Biological Process | 0.0 | - |
Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G17580.1 | MYA1, ATMYA1, XI-1 myosin 1 chr1:6039453-6049309 FORWARD LENGTH=1520 | 3.00004e-41 | 93% |
RefSeq | Arabidopsis thaliana | NP_173201.2 | myosin 1 [Arabidopsis thaliana] | 4.00001e-41 | 93% |
RefSeq | Populus trichocarpa | XP_002302064.1 | predicted protein [Populus trichocarpa] | 1.99993e-41 | 88% |
![]() |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5B1K8
Fln msg: Distance to subject end: 230 aas, your sequence is shorter than subject: 72 - 357
Fln protein:
V
Protein Length:
73
Fln nts:
G
Fln Alignment:
HIF1XHV02DCGIT___VLEAFGNAKTVRNNNSSRFGKFVELQFDKTGRISGAAVRTYLLERSRVCQLSDPERNYHCFYLLCAAPPEDI
A5B1K8________________VLEAFGNAKTVRNNNSSRFGKFVEIQFDQRGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAAPPEDV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain