|
||||||
|
UniGene Name: sp_v3.0_unigene149299
Length: 203 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene149299
A |
|
Ace file of the UniGene sp_v3.0_unigene149299
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Flavine-containing monoxygenase n=2 Tax=Malpighiales RepID=B9GRA6_POPTR | - | - | 8.0e-19 | 64% |
| FL-Next | sp=Flavin-containing monooxygenase YUCCA9; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 60% |
| Sma3 | Flavine-containing monoxygenase | - | - | 2.498e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavin-containing monooxygenase. | EC:1.14.13.8 | - | 4.37e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methane metabolism | 00680 | 4.37e-12 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 4.37e-12 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g32540; At1g04180; At2g33230; At4g32540; At5g11320; At5g25620; At5g43890; B1340F09.23; F20D22.5; F2I11_210; FML1; FML2; FML3; FML4; FML5; FML6; FML7; GSVIVT00016745001; GSVIVT00020401001; GSVIVT00028461001; GSVIVT00032480001; GSVIVT00032585001; L23H3.2 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | N,N-dimethylaniline monooxygenase activity | GO:0004499 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | auxin biosynthetic process | GO:0009851 | Biological Process | 0.0 | - |
| Sma3 | positive regulation of flower development | GO:0009911 | Biological Process | 0.0 | - |
| Sma3 | inflorescence development | GO:0010229 | Biological Process | 0.0 | - |
| Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, class-II | IPR000103 | - | 0.0 | - |
| Sma3 | Flavin monooxygenase FMO | IPR000960 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Monooxygenase, FAD-binding | IPR002938 | - | 0.0 | - |
| Sma3 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR003016 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G04180.1 | YUC9 YUCCA 9 chr1:1104623-1105988 FORWARD LENGTH=421 | 2.0e-24 | 60% |
| RefSeq | Arabidopsis thaliana | NP_171914.1 | YUCCA 9 protein [Arabidopsis thaliana] | 3.0e-24 | 60% |
| RefSeq | Populus trichocarpa | XP_002303099.1 | flavine-containing monoxygenase [Populus trichocarpa] | 5.0e-25 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O64489
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 135 aas, your sequence is shorter than subject: 67 - 421
Fln protein:
C
Protein Length:
68
Fln nts:
A
Fln Alignment:
HIF1XHV02EXKHP___VHVLPREMFGRSTFGVAIWLMKWLPLWLVDMFLLCVAWLMFGSTERYGIKRPLMGPLELKNKVG
O64489________________VHVLPREIMGKSTFGISVMMMKWLPLWLVDKLLLILSWLVLGSLSNYGLKRPDIGPMELKSMTG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
