SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene149290

Length: 178 nt

UniGene Fasta

>sp_v3.0_unigene149290
CTGCTGCCCCTGAAGGGATGGGCCTCCCCATGTGCGTGACAGGAGCAGGGGGATACATCGGATCATGGCTCGTAAAGACTCTGCTGGAGAATGGGTACACAGTGCATGCCACTCTCAGAGATCCACACAACCCTTCAAAGAACTCATGCCTTCTCTCACTCCCAGGGGCCCAAGAGAG

Ace file of the UniGene sp_v3.0_unigene149290

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Cinnamyl alcohol dehydrogenase [Prunus mume]	-	-	4.0e-12	62%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	93%
Sma3	Dihydroflavonol 4-reductase	-	-	1.63e-34	-

Source	ECs	Term	Type	e value	Identity
Sma3	Dihydrokaempferol 4-reductase.	EC:1.1.1.219	-	3.871e-14	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Flavonoid biosynthesis	00941		3.871e-14	%
Sma3	Biosynthesis of phenylpropanoids	01061		3.871e-14	%
Sma3	Metabolic pathways	01100		3.871e-14	%
Sma3	Biosynthesis of secondary metabolites	01110		3.871e-14	%
Sma3	Cinnamoyl-CoA reductase.	EC:1.2.1.44	-	7.985e-16	-

Source	KEGGs	Term	e value	Identity
Sma3	Phenylpropanoid biosynthesis	00940	7.985e-16	%
Sma3	Biosynthesis of phenylpropanoids	01061	7.985e-16	%
Sma3	Metabolic pathways	01100	7.985e-16	%
Sma3	Biosynthesis of secondary metabolites	01110	7.985e-16	%

Source	Gene names
Sma3	A1* (second gene); A1* (second gene)/ (Teosinte); AN6; ANT18; AeloDFR-S1; AeseDFR-S1; AeshDFR-S1; AespDFR-S1; AesqDFR-D1; ApDFR; At1g80820; CAD1-1; CAD1-7; CCR; CCR1; CCR2; CCR3; CCR4; CCR5; CCR6; CCRL3; CCRL4; CtDFR; DFR; DFR-B; DFR-C; DFR-FL2; DFR1; DFR

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	transcription repressor activity	GO:0016564	Molecular Function	-
Sma3	cinnamoyl-CoA reductase activity	GO:0016621	Molecular Function	-
Sma3	dihydrokaempferol 4-reductase activity	GO:0045552	Molecular Function	-
Sma3	coenzyme binding	GO:0050662	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	regulation of nitrogen utilization	GO:0006808	Biological Process	-
Sma3	flavonoid biosynthetic process	GO:0009813	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	cellular metabolic process	GO:0044237	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	NAD-dependent epimerase/dehydratase	IPR001509	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	3-beta hydroxysteroid dehydrogenase/isomerase	IPR002225	-	-
Sma3	NmrA-like	IPR008030	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G19440.1	NAD(P)-binding Rossmann-fold superfamily protein chr5:6556493-6558123 FORWARD LENGTH=326	5.0e-16	59%
RefSeq	Arabidopsis thaliana	NP_197445.1	Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana]	7.0e-16	59%
RefSeq	Populus trichocarpa	XP_002314053.1	cinnamoyl CoA reductase-like protein, partial [Populus trichocarpa]	1.0e-15	61%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: A9P2K5

Fln msg: Distance to subject end: 274 aas, atg_distance in limit (1-15): atg_distance = 6, your sequence is shorter than subject: 53 - 338

Fln protein: MGLPMCVTGAGGYIGSWLVKTLLENGYTVHATLRDPHNPSKNSCLLSLPGAQE

Protein Length: 54

Fln nts: CTGCTGCCCCTGAAGGG_-_ATGGGCCTCCCCATGTGCGTGACAGGAGCAGGGGGATACATCGGATCATGGCTCGTAAAGACTCTGCTGGAGAATGGGTACACAGTGCATGCCACTCTCAGAGATCCACACAACCCTTCAAAGAACTCATGCCTTCTCTCACTCCCAGGGGCCCAAGAGAG

Fln Alignment:

HIF1XHV02ESC7B___AAPEGMGLPMCVTGAGGYIGSWLVKTLLENGYTVHATLRDPHNPSKNSCLLSLPGAQE
A9P2K5________________AVPEGKGLPVCVTGAGGYIGSWLVKTLLENGYTVHATLRDPGNPSKNSCLLSLPGAQE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain