|
||||||
|
UniGene Name: sp_v3.0_unigene149272
Length: 209 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene149272
T |
|
Ace file of the UniGene sp_v3.0_unigene149272
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative pectate lyase 14 n=4 Tax=Arabidopsis RepID=PLY14_ARATH | - | - | 4.0e-32 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Sma3 | Pectate lyase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pectate lyase. | EC:4.2.2.2 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose and glucuronate interconversions | 00040 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | 9612; AT3G01270; AT59; At1g04680; At1g11920; At1g14420; At1g30350; At1g67750; At2g02720; At3g01270; At3g07010; At3g24230; At3g24670; At3g27400; At3g53190; At3g54920; At4g13210; At4g13710; At4g22080; At4g22090; At4g24780; At5g15110; At5g48900; At5g55720; A |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | anchored to membrane | GO:0031225 | Cellular Component | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | lyase activity | GO:0016829 | Molecular Function | 0.0 | - |
| Sma3 | pectate lyase activity | GO:0030570 | Molecular Function | 0.0 | - |
| Sma3 | plant-type cell wall organization | GO:0009664 | Biological Process | 0.0 | - |
| Sma3 | defense response, incompatible interaction | GO:0009814 | Biological Process | 0.0 | - |
| Sma3 | cell wall modification involved in multidimensional cell growth | GO:0042547 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Domain of unknown function DUF11 | IPR001434 | - | 0.0 | - |
| Sma3 | Pectate lyase/Amb allergen | IPR002022 | - | 0.0 | - |
| Sma3 | Parallel beta-helix repeat | IPR006626 | - | 0.0 | - |
| Sma3 | Pectate lyase, N-terminal | IPR007524 | - | 0.0 | - |
| Sma3 | Pectin lyase fold | IPR012334 | - | 0.0 | - |
| Sma3 | AmbAllergen | IPR018082 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G13210.2 | - | 4.99997e-41 | 91% |
| RefSeq | Arabidopsis thaliana | NP_193057.4 | putative pectate lyase 14 [Arabidopsis thaliana] | 4.00001e-41 | 91% |
| RefSeq | Populus trichocarpa | XP_002321242.1 | predicted protein, partial [Populus trichocarpa] | 1.99993e-41 | 89% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ36
Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 69 - 426
Fln protein:
T
Protein Length:
70
Fln nts:
T
Fln Alignment:
HIF1XHV02DXFKM___TIAYNHFGKGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPDNALAKEVTKRIN
B8LQ36________________TVAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPANPLAKEVTKRIN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
