UniGene Name: sp_v3.0_unigene149243
Length: 194 nt
![]() |
---|
>sp_v3.0_unigene149243
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | cysteine proteinase [Phalaenopsis sp. SM9108] | - | - | 4.0e-17 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
Sma3 | Cysteine proteinase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 7.532e-11 | - |
Sma3 | Hydrolases, Acting on peptide bonds (peptide hydrolases), Cysteine endopeptidases. | EC:3.4.22.- | - | 5.60519e-45 | - |
Sma3 | Zingipain. | EC:3.4.22.67 | - | 8.435e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g20850; At1g47128; At3g19390; At3g19400; At3g19400/MLD14.12; At3g48350; At3g48350/T29H11_130; At4g35350; At4g36880; At5g45890; At5g50260; B1417F08.21; BoCysP1; BrCysP1; C7A10.480; CP1; CP2; CP7; CPRF; CPRZ; CSCP; CYS2; CYSEP; CysEP; CysP1; CysP2; DcCys |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum lumen | GO:0005788 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | senescence-associated vacuole | GO:0010282 | Cellular Component | 0.0 | - |
Sma3 | cytoplasmic vesicle | GO:0031410 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | cysteine-type endopeptidase activity | GO:0004197 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | developmental programmed cell death | GO:0010623 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anaphylatoxin/fibulin | IPR000020 | - | 0.0 | - |
Sma3 | Granulin | IPR000118 | - | 0.0 | - |
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain C-terminal | IPR000668 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Ribosomal protein L5 | IPR002132 | - | 0.0 | - |
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Phospholipase A2, active site | IPR013090 | - | 0.0 | - |
Sma3 | Peptidase C1A, papain | IPR013128 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I29, cathepsin propeptide | IPR013201 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | IPR018069 | - | 0.0 | - | |
Sma3 | Heat shock protein DnaJ, conserved site | IPR018253 | - | 0.0 | - |
Sma3 | Ribosomal protein L29, conserved site | IPR018254 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G50260.1 | Cysteine proteinases superfamily protein chr5:20455605-20456862 FORWARD LENGTH=361 | 7.0e-23 | 65% |
RefSeq | Arabidopsis thaliana | NP_568722.1 | putative cysteine proteinase [Arabidopsis thaliana] | 9.0e-23 | 65% |
RefSeq | Populus trichocarpa | XP_002321655.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 65% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LMA7
Fln msg: Distance to subject end: 196 aas, your sequence is shorter than subject: 64 - 372
Fln protein:
E
Protein Length:
65
Fln nts:
G
Fln Alignment:
HIF1XHV02D9II7___EKHKSLRRDRGTQSGSFMYQNSTSLPESIDWRKKGAVTPVKNQGQCGSCWAFSTVAAVESINYI
B8LMA7________________EKHKSLRGDRGVESGSFMYQNSKRLPASIDWRKKGAVTPVKNQGQCGSCWAFSTIASVEGINYI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain