UniGene Name: sp_v3.0_unigene149227
Length: 240 nt
UniGene Fasta |
---|
>sp_v3.0_unigene149227
C |
Ace file of the UniGene sp_v3.0_unigene149227 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Os11g0224300 protein (Fragment) n=2 Tax=Oryza sativa Japonica Group RepID=Q0ITS1_ORYSJ | - | - | 7.0e-14 | 55% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 52% |
Sma3 | Putative retroelement | - | - | 1.354e-08 | - |
Source | Gene names |
---|---|
Sma3 | LOC_Os03g05340; LOC_Os03g09990; LOC_Os11g32060; LOC_Os12g31470; OSJNBa0019J05.12; OSJNBa0064E16.2; OSJNBa0067N01.11; OSJNBa0071I20.1; OSJNBb0081F12.24; Os04g0283700; P0676G05.19; VITISV_008352; VITISV_013478; VITISV_014148; VITISV_038293; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Leucine-rich repeat-containing N-terminal, type 2 | IPR013210 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5C5K2
Fln msg: Overlapping hits, possible frame ERROR between 108 and 102, Distance to subject end: 26 aas, your sequence is shorter than subject: 80 - 1360
Fln protein:
L
Protein Length:
81
Fln nts:
C
Fln Alignment:
HIF1XHV02DL7VO___MKQ*ADQHRSKRTFQ-GDHIFLQLQPYKQTSLKExxFPELA*KFYGPYQILQRIGAVAYKLALPPTSKIYPVFHVSCLKK
A5C5K2________________MKCQADQHRRDASFAVGDYVYLKLQPYRQTSVAFxxSMKLAPRFFGPYQVIEKVGSVAYKLALPPGSQIHNVFHVSLLRR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain