UniGene Name: sp_v3.0_unigene149169
Length: 164 nt
![]() |
---|
>sp_v3.0_unigene149169
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glycoside hydrolase, family 28 n=1 Tax=Medicago truncatula RepID=Q2HVV9_MEDTR | - | - | 2.0e-16 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Polygalacturonase | - | - | 2.2e-29 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Polygalacturonase. | EC:3.2.1.15 | - | 1.073e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose and glucuronate interconversions | 00040 | 1.073e-19 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 1.073e-19 | % | |
Sma3 | Metabolic pathways | 01100 | 1.073e-19 | % |
Source | Gene names |
---|---|
Sma3 | ADPG2; At1g70500; At2g41850; F24J13.7; GSVIVT00002738001; GSVIVT00025514001; GSVIVT00025516001; GSVIVT00025518001; GSVIVT00025571001; GSVIVT00028778001; GSVIVT00028779001; GSVIVT00034593001; LOC_Os03g11760; MAPG1; MtrDRAFT_AC148340g17v2; OJ1119_B04.34; OJ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | polygalacturonase activity | GO:0004650 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | cell wall modification involved in abscission | GO:0009830 | Biological Process | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | anther dehiscence | GO:0009901 | Biological Process | 0.0 | - |
Sma3 | fruit dehiscence | GO:0010047 | Biological Process | 0.0 | - |
Sma3 | floral organ abscission | GO:0010227 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 28 | IPR000743 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Parallel beta-helix repeat | IPR006626 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Pectin lyase fold | IPR012334 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70500.1 | Pectin lyase-like superfamily protein chr1:26566579-26568729 REVERSE LENGTH=468 | 6.0e-19 | 64% |
RefSeq | Arabidopsis thaliana | NP_177207.1 | pectin lyase-like protein [Arabidopsis thaliana] | 7.0e-19 | 64% |
RefSeq | Populus trichocarpa | XP_002299601.1 | predicted protein [Populus trichocarpa] | 1.0e-20 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQX9
Fln msg: Distance to subject end: 114 aas, your sequence is shorter than subject: 54 - 493
Fln protein:
V
Protein Length:
55
Fln nts:
A
Fln Alignment:
HIF1XHV02EVVP9___VMVHGAFLENTTNGLRIKTWQGSSGFARRITFQNVQMQNVKHPIIIDQYYCDSK
B8LQX9________________VMVHGAFLHNTTNGLRIKTWQGSSGSARRILFQNVHMENVKHPIIIDQYYCDSK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain