UniGene Name: sp_v3.0_unigene149131
Length: 245 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene149131
C |
Ace file of the UniGene sp_v3.0_unigene149131
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | zinc finger protein [Arabidopsis thaliana] | - | - | 8.0e-14 | 45% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
| Sma3 | Ran GTPase binding protein, putative | - | - | 2.006e-22 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g31880; At1g54180; At1g54190; At1g69710; At1g76950; At2g35600; At3g14000; At5g12350; At5g19420; At5g20530; At5g20540; At5g42140; B1111C03.19; B1116H04.7; BRX; BRXL1; BRXL2; BRXL3; BRXL4; CCF; F15I1.28; F22K20.5; F5M6.11; F7C8.130; GSVIVT00002262001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Zinc finger, FYVE-type | IPR000306 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
| Sma3 | NB-ARC | IPR002182 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation/beta-lactamase-inhibitor protein II | IPR009091 | - | 0.0 | - |
| Sma3 | Pleckstrin homology-like domain | IPR011993 | - | 0.0 | - |
| Sma3 | Brevis radix-like domain | IPR013591 | - | 0.0 | - |
| Sma3 | Zinc finger, FYVE-related | IPR017455 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G42140.1 | Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain chr5:16837547-16841640 REVERSE LENGTH=1073 | 2.0e-21 | 65% |
| RefSeq | Arabidopsis thaliana | NP_199029.1 | Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain [Arabidopsis thaliana] | 2.0e-21 | 65% |
| RefSeq | Populus trichocarpa | XP_002300931.1 | predicted protein [Populus trichocarpa] | 5.0e-20 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NN54
Fln msg: STOP codon was not found. Distance to subject end: 5 aas, your sequence is shorter than subject: 81 - 342
Fln protein:
H
Protein Length:
82
Fln nts:
C
Fln Alignment:
HIF1XHV02C6F9Q___EVETEWVEQDEPGVYITLLSLSDGTKELKXXXXXXXXXXXXQAENWWSENRARVFEQY
A9NN54________________EQEQEWVEEDEPGVYVTIRCSPAGSREIRRVRFSREKFSEMQARLWWEENRLRIHEQY

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta