UniGene Name: sp_v3.0_unigene149063
Length: 162 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene149063
A |
Ace file of the UniGene sp_v3.0_unigene149063 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | PREDICTED: similar to Aldehyde dehydrogenase, mitochondrial precursor (ALDH class 2) (ALDH1) (ALDH-E2) n=1 Tax=Ciona intestinalis RepID=UPI000180BF08 | - | - | 8.0e-14 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Mitochondrial aldehyde dehydrogenase | - | - | 2.979e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase (NAD(+)). | EC:1.2.1.3 | - | 3.118e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycolysis / Gluconeogenesis | 00010 | 3.118e-06 | % | |
Sma3 | Pentose and glucuronate interconversions | 00040 | 3.118e-06 | % | |
Sma3 | Ascorbate and aldarate metabolism | 00053 | 3.118e-06 | % | |
Sma3 | Fatty acid metabolism | 00071 | 3.118e-06 | % | |
Sma3 | Valine, leucine and isoleucine degradation | 00280 | 3.118e-06 | % | |
Sma3 | Lysine degradation | 00310 | 3.118e-06 | % | |
Sma3 | Arginine and proline metabolism | 00330 | 3.118e-06 | % | |
Sma3 | Histidine metabolism | 00340 | 3.118e-06 | % | |
Sma3 | Tryptophan metabolism | 00380 | 3.118e-06 | % | |
Sma3 | beta-Alanine metabolism | 00410 | 3.118e-06 | % | |
Sma3 | Glycerolipid metabolism | 00561 | 3.118e-06 | % | |
Sma3 | Pyruvate metabolism | 00620 | 3.118e-06 | % | |
Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 3.118e-06 | % | |
Sma3 | Propanoate metabolism | 00640 | 3.118e-06 | % | |
Sma3 | Limonene and pinene degradation | 00903 | 3.118e-06 | % | |
Sma3 | Metabolic pathways | 01100 | 3.118e-06 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.118e-06 | % |
Source | Gene names |
---|---|
Sma3 | ALDH2; ALDH2B; ALDH2B7; ALDH2a; ALDH2b; ALDH3; Aldh; Aldh2a; Aldh2b; At1g23800; F5O8.33; F5O8.35; GSVIVT00028841001; GSVIVT00028844001; OSJNBa0072H09.28-1; OSJNBa0072H09.28-2; OSJNBa0084K06.38; Os01g0591300; Os02g0730000; Os06g0270900; OsI_02651; OsI_0265 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
Sma3 | aldehyde dehydrogenase (NAD) activity | GO:0004029 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aldehyde dehydrogenase domain | IPR015590 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, N-terminal | IPR016162 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, C-terminal | IPR016163 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G23800.1 | ALDH2B7, ALDH2B aldehyde dehydrogenase 2B7 chr1:8412238-8414804 REVERSE LENGTH=534 | 3.0e-16 | 62% |
RefSeq | Arabidopsis thaliana | NP_564204.1 | aldehyde dehydrogenase 2B7 [Arabidopsis thaliana] | 4.0e-16 | 62% |
RefSeq | Populus trichocarpa | XP_002301540.1 | predicted protein [Populus trichocarpa] | 1.0e-16 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P2L9
Fln msg: STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 53 - 200
Fln protein:
I
Protein Length:
54
Fln nts:
A
Fln Alignment:
HIF1XHV02DV8XQ___IMDDANVDEAVDLAHLAVYVNMGQVCCAGSRVFVQEGIYDEFLKKAVARAKQQ
A9P2L9________________IMDDADVDKAVNIAHLAIYSNMGQVCLAGSRVFVQEGIYDEFVKKAVARAKQQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain