UniGene Name: sp_v3.0_unigene149051
Length: 236 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene149051
A |
Ace file of the UniGene sp_v3.0_unigene149051 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Sucrose synthase n=1 Tax=Pinus taeda RepID=A6N837_PINTA | - | - | 5.0e-24 | 87% |
FL-Next | tr=Sucrose synthase; Pinus taeda (Loblolly pine). | - | - | 0.0 | 87% |
Sma3 | Sucrose synthase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sucrose synthase. | EC:2.4.1.13 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At3g43190; At4g02280; At5g20830; At5g49190; B1056G08.118; BoSS; CSS1; CitSS2; CitSUS1; CitSUS1-2; CitSUSA; CitSUSA-2; F7K15_40; FaSS; GSVIVT00003157001; GSVIVT00016378001; GSVIVT00023450001; GSVIVT00026116001; GSVIVT00028036001; GSVIVT00033041001; GmSS; H |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | sucrose synthase activity | GO:0016157 | Molecular Function | 0.0 | - |
Sma3 | sucrose-phosphate synthase activity | GO:0046524 | Molecular Function | 0.0 | - |
Sma3 | response to hypoxia | GO:0001666 | Biological Process | 0.0 | - |
Sma3 | sucrose metabolic process | GO:0005985 | Biological Process | 0.0 | - |
Sma3 | response to osmotic stress | GO:0006970 | Biological Process | 0.0 | - |
Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to flooding | GO:0009413 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sucrose synthase | IPR000368 | - | 0.0 | - |
Sma3 | Glycosyl transferase, family 1 | IPR001296 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Sucrose synthase, plant/cyanobacteria | IPR012820 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G43190.1 | SUS4, ATSUS4 sucrose synthase 4 chr3:15179204-15182577 REVERSE LENGTH=808 | 8.0e-26 | 75% |
RefSeq | Arabidopsis thaliana | NP_566865.2 | sucrose synthase 4 [Arabidopsis thaliana] | 1.0e-25 | 75% |
RefSeq | Populus trichocarpa | XP_002324136.1 | hypothetical protein POPTRDRAFT_835735 [Populus trichocarpa] | 6.0e-25 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A6N837
Fln msg: Distance to subject end: 380 aas, your sequence is shorter than subject: 78 - 833
Fln protein:
N
Protein Length:
79
Fln nts:
A
Fln Alignment:
HIF1XHV02C5U8J___DVSNEVTAELKGQPDLIIGNYRDGNLVATLMAHRQGITQCNIAHALEKTKYPDSDIYW
A6N837________________DVTNEIAVELKGQPDLIIGNYSDGNLVASLMAHKQGITQCNIAHALEKTKYPDSDIYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain