|
||||||
|
UniGene Name: sp_v3.0_unigene149012
Length: 175 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene149012
G |
|
Ace file of the UniGene sp_v3.0_unigene149012
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | GDP-L-galactose phosphorylase [Arabidopsis thaliana] sp|Q8RWE8.1|GGAP1_ARATH RecName: Full=GDP-L-galactose phosphorylase 1; AltName: Full=Protein VITAMIN C DEFECTIVE 2 gb|AAM13137.1| putative protein [Arabidopsis thaliana] gb|AAP31933.1| At4g26850 [Arabid | - | - | 8.0e-14 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | VTC2-like protein | - | - | 3.48e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | At4g26850; At5g55120; GSVIVT00022399001; GSVIVT00027274001; LOC_Os12g08810; Os12g0190000; OsI_37726; OsJ_35472; PHYPADRAFT_166416; PHYPADRAFT_3338; POPTRDRAFT_552990; POPTRDRAFT_642193; POPTRDRAFT_660608; RCOM_0278070; RCOM_0284300; RCOM_0752930; VITISV_0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | mannose-1-phosphate guanylyltransferase (GDP) activity | GO:0008928 | Molecular Function | 0.0 | - |
| Sma3 | GDP-galactose:mannose-1-phosphate guanylyltransferase activity | GO:0010471 | Molecular Function | 0.0 | - |
| Sma3 | GDP-galactose:glucose-1-phosphate guanylyltransferase activity | GO:0010472 | Molecular Function | 0.0 | - |
| Sma3 | GDP-galactose:myoinositol-1-phosphate guanylyltransferase activity | GO:0010473 | Molecular Function | 0.0 | - |
| Sma3 | glucose-1-phosphate guanylyltransferase (GDP) activity | GO:0010474 | Molecular Function | 0.0 | - |
| Sma3 | galactose-1-phosphate guanylyltransferase (GDP) activity | GO:0010475 | Molecular Function | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
| Sma3 | L-ascorbic acid biosynthetic process | GO:0019853 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Stigma-specific protein Stig1 | IPR006969 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G26850.1 | " VTC2 mannose-1-phosphate guanylyltransferase (GDP)s;GDP-galactose:mannose-1-phosphate guanylyltransferases;GDP-galactose:glucose-1-phosphate guanylyltransferases;GDP-galactose:myoinositol-1-phosphate guanylyltransferases;glucose-1-phosphate guanylyltra | 8.0e-19 | 62% |
| RefSeq | Arabidopsis thaliana | NP_567759.1 | GDP-L-galactose phosphorylase [Arabidopsis thaliana] | 1.0e-18 | 62% |
| RefSeq | Populus trichocarpa | XP_002298816.1 | predicted protein [Populus trichocarpa] | 2.0e-19 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM04
Fln msg: Distance to subject end: 246 aas, your sequence is shorter than subject: 57 - 435
Fln protein:
K
Protein Length:
58
Fln nts:
G
Fln Alignment:
HLKU4M001CE8BD___KFNFTKVGQDEVLFRFEESEENKIQYLEKAPVFDSPNVIAINVSPIEYGHVLLVPRV
B8LM04________________KFNFTKVGQEEVLFRFEESEEGKVQYLEKAPVLDSPNVIAINVSPIEYGHVLLVPRV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
