SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene148911

Length: 337 nt

UniGene Fasta

>sp_v3.0_unigene148911
GCCCACCTCAATGGTGAAAGTGGCCAAGTTGATGGACAGCTACCTTGCTGAAATAGCTTACGATGTCAACCTCGATGTTTCGAGCTTTGAAGCATTGGCTGACGGTCTTCCGTGTGATGCTCGGACCTGTGACGATGGTTTGTACAGGGCCATAGACACCTATCTCAAGACTCATTCAGGAATCTCTGAGGTGGAGAGGAGAAGACTCTGTAGATTAATGGACTGTCAGAAGCTCTCGGCTGATGCATGCTTTCATGCTGCTCAGAATGAACGGCTTCCCATCCGAACAGTGGTCCATGTTCTTTCTGCGAGCAGATGAGGCTTAAAAATGCTAAAG

Ace file of the UniGene sp_v3.0_unigene148911

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	NPH3 domain containing protein	-	-	3.99931e-42	63%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	60%
Sma3	Transposon protein Mutator sub-class	-	-	2.816e-16	-

Source	Gene names
Sma3	5; 80A08_21; AT4g37590; At1g03010; At1g30440; At1g52770; At1g67900; At2g14820; At2g23050; At2g23050/F21P24.11; At2g30510; At2g30520; At2g30520/At2g30510; At2g47860; At3g08570; At3g08660; At3g15570; At3g26490; At3g44820; At4g37590; At4g37590/F19F18.80; At5

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	signal transducer activity	GO:0004871	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	response to light stimulus	GO:0009416	Biological Process	-
Sma3	phototropism	GO:0009638	Biological Process	-
Sma3	blue light signaling pathway	GO:0009785	Biological Process	-
Sma3	phloem or xylem histogenesis	GO:0010087	Biological Process	-
Sma3	leaf vascular tissue pattern formation	GO:0010305	Biological Process	-
Sma3	cotyledon vascular tissue pattern formation	GO:0010588	Biological Process	-
Sma3	shoot development	GO:0048367	Biological Process	-
Sma3	primary root development	GO:0080022	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1 complex, gamma subunit	IPR000131	-	-
Sma3	BTB/POZ-like	IPR000210	-	-
Sma3	Nitrogenase component 1, conserved site	IPR000318	-	-
Sma3	Zinc finger, CCCH-type	IPR000571	-	-
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	NPH3	IPR004249	-	-
Sma3	Histone H1/H5	IPR005818	-	-
Sma3	TonB box, conserved site	IPR010916	-	-
Sma3	BTB/POZ fold	IPR011333	-	-
Sma3	Winged helix-turn-helix transcription repressor DNA-binding	IPR011991	-	-
Sma3		IPR012287	-	-
Sma3	BTB/POZ	IPR013069	-	-
Sma3		IPR013089	-	-
Sma3		IPR014778	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	Myb domain, DNA-binding	IPR017930	-	-
Sma3	Superoxide dismutase, copper/zinc, binding site	IPR018152	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	Peroxidases heam-ligand binding site	IPR019793	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G64330.1	NPH3, RPT3, JK218 Phototropic-responsive NPH3 family protein chr5:25727568-25730225 FORWARD LENGTH=746	3.0e-39	68%
RefSeq	Arabidopsis thaliana	NP_568989.1	root phototropism protein 3 [Arabidopsis thaliana]	4.0e-39	68%
RefSeq	Populus trichocarpa	XP_002323955.1	predicted protein [Populus trichocarpa]	2.0e-40	64%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPD8

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 139 aas, your sequence is shorter than subject: 106 - 648

Fln protein: PTSMVKVAKLMDSYLAEIAYDVNLDVSSFEALADGLPCDARTCDDGLYRAIDTYLKTHSGISEVERRRLCRLMDCQKLSADACFHAAQNERLPIRTVVHVLSASR*

Protein Length: 107

Fln nts: GCCCACCTCAATGGTGAAAGTGGCCAAGTTGATGGACAGCTACCTTGCTGAAATAGCTTACGATGTCAACCTCGATGTTTCGAGCTTTGAAGCATTGGCTGACGGTCTTCCGTGTGATGCTCGGACCTGTGACGATGGTTTGTACAGGGCCATAGACACCTATCTCAAGACTCATTCAGGAATCTCTGAGGTGGAGAGGAGAAGACTCTGTAGATTAATGGACTGTCAGAAGCTCTCGGCTGATGCATGCTTTCATGCTGCTCAGAATGAACGGCTTCCCATCCGAACAGTGGTCCATGTTCTTTCTGCGAGCAGATGAGGCTTAAAAATGCTAAAG

Fln Alignment:

HLKU4M001BL5PO___TSMVKVAKLMDSYLAEIAYDVNLDVSSFEALADGLPCDARTCDDGLYRAIDTYLKTHSGISEVERRRLCRLMDCQKLSADACFHAAQNERLPIRTVVHVL
B8LPD8________________TPIMMVGKLVDGYLAEVAPDGNLKPAKFHSLADALPDYARLFDDGLYRAIDIYLKAHPWVTEEEREKICSIMDCQKLTLEACTHAAQNERLPLRVVVQVL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain