UniGene Name: sp_v3.0_unigene148873
Length: 186 nt
UniGene Fasta |
---|
>sp_v3.0_unigene148873
A |
Ace file of the UniGene sp_v3.0_unigene148873 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | sp=Uncharacterized mitochondrial protein AtMg00860; Arabidopsis thaliana (Mouse-ear cress). Mitochondrion. | - | - | 0.0 | 57% |
Source | Gene names |
---|---|
Sma3 | LOC_Os03g05350; LOC_Os03g26020; OSIGBa0111L12.7; OSJNBa0067N01.10; OSJNBa0088I22.10; OSJNBb0014D23.8; OSJNBb0048D20.16; Os06g0570000; Os06g0590100; Os07g0518300; Os09g0135100; T21B14.24; VITISV_011880; VITISV_012977; VITISV_013041; VITISV_014148; VITISV_0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Intron-encoded nuclease 2 | IPR003611 | - | 0.0 | - |
Sma3 | Transposase, MuDR, plant | IPR004332 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF594 | IPR007658 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | ATMG00860.1 | ORF158 DNA/RNA polymerases superfamily protein chrM:235916-236392 FORWARD LENGTH=158 | 5.0e-15 | 57% |
RefSeq | Arabidopsis thaliana | NP_085542.1 | hypothetical protein ArthMp075 (mitochondrion) [Arabidopsis thaliana] | 7.0e-15 | 57% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P92523
Fln msg: Distance to subject end: 35 aas, your sequence is shorter than subject: 61 - 158
Fln protein:
S
Protein Length:
62
Fln nts:
A
Fln Alignment:
HLKU4M001A5ZLL___LRGFLGLIRYYRKFVKNYGRIGTPLTTLLKKDAFSWTPKATKVFEHLKEAMCQALVL
P92523________________LRGFLGLTGYYRRFVKNYGKIVRPLTELLKKNSLKWTEMAALAFKALKGAVTTLPVL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain