UniGene Name: sp_v3.0_unigene148559
Length: 213 nt
UniGene Fasta |
---|
>sp_v3.0_unigene148559
G |
Ace file of the UniGene sp_v3.0_unigene148559 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | CBL-interacting protein kinase 20 n=4 Tax=Andropogoneae RepID=C4P7S9_SORBI | - | - | 4.0e-17 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
Sma3 | CBL-interacting serine/threonine-protein kinase, putative | - | - | 4.27e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 1.815e-23 | - |
Sma3 | Calcium/calmodulin-dependent protein kinase. | EC:2.7.11.17 | - | 1.32e-13 | - |
Source | Gene names |
---|---|
Sma3 | ATPK10; At1g29230; At2g34180; At4g18700; At4g30960; At5g01810; At5g07070; At5g45810; At5g45820; B1131G08.36; CIPK; CIPK10; CIPK11; CIPK12; CIPK13; CIPK14; CIPK15; CIPK17; CIPK18; CIPK19; CIPK2; CIPK20; CIPK21; CIPK22; CIPK23; CIPK24; CIPK26; CIPK28; CIPK3 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | NAF domain | IPR004041 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | NAF/FISL domain | IPR018451 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G45820.1 | CIPK20, SnRK3.6, PKS18 CBL-interacting protein kinase 20 chr5:18587081-18588400 REVERSE LENGTH=439 | 3.0e-18 | 72% |
RefSeq | Arabidopsis thaliana | NP_199394.1 | CBL-interacting serine/threonine-protein kinase 20 [Arabidopsis thaliana] | 3.0e-18 | 72% |
RefSeq | Populus trichocarpa | XP_002323059.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-18 | 74% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NWA3
Fln msg: Overlapping hits, possible frame ERROR between 152 and 130, Distance to subject end: 359 aas, your sequence is shorter than subject: 68 - 426
Fln protein:
M
Protein Length:
69
Fln nts:
G
Fln Alignment:
HLKU4M001BHC9V___METKPNILMGRYELGRLLGHGTFAKVYHARNLKTGESVAxxxxxxxxLLKVGMIEPIKREISVMKLV
A9NWA3________________MEMKPNILMGRYELGRLLGQGTFAKVYYAKTLKTGESVAxxxxxxxxILKVGMIEQIKREISVMRLV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain